KEGG   Columba livia (rock pigeon): 102083979
Entry
102083979         CDS       T02912                                 

Gene name
ZMAT3
Definition
(RefSeq) zinc finger matrin-type protein 3
  KO
K10137  zinc finger, matrin type 3
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102083979 (ZMAT3)
SSDB
Motif
Pfam: zf-met zf-C2H2_jaz TUTase zf-C2H2_2 zf-U1
Other DBs
NCBI-GeneID: 102083979
NCBI-ProteinID: XP_005506627
UniProt: A0A2I0MBB8
LinkDB
Position
Unknown
AA seq 289 aa
MILLQQAGLLPHPEKPSSLPMSVATRPRASSPLSPPKSLGLGPSFHQTQEEELAKVVEQD
PMLEELCKPLCCKLCNVTLNSAQQAQAHYQGKNHSKKLRNYYAANSCPASARMSSSVEPA
PPQVVSLPAQMGSSKPGGRVILATENDYCKLCDASFSSPAVAQAHYQGKNHAKRLRLAEA
QNNSFSDASELGKRRARKEGNEYKMMQNRRNTYTVQNNTGPYFNPRSRQRIPRDLAMCVT
PSGQFYCSMCNAGASEEMEFRQHLESKQHKSKVSEQRYRNEMENLGYVQ
NT seq 870 nt   +upstreamnt  +downstreamnt
atgattcttctacagcaagcaggccttcttcctcatcctgagaagccttcatctcttcct
atgtcagtggctacaaggccaagagccagctcaccactgtccccaccaaaatctctcgga
ctggggccttcctttcatcagacacaagaagaagagcttgcaaaggtggtggagcaggac
cctatgctggaggaactatgtaagcctctgtgctgcaagctttgcaatgtcactctgaat
tcagcacaacaagcccaggctcattaccagggtaaaaaccacagtaagaaactccgaaat
tactatgctgccaatagctgtccggcatctgccaggatgagtagttcggttgagcctgcc
ccacctcaggttgtctcccttccagctcagatgggatccagtaaaccaggtggccgagtg
atcctggccacggagaatgattactgcaagctttgtgatgcctcatttagctctccagct
gtggcacaagctcactaccaagggaaaaatcacgccaaacggctgcgtcttgcagaagca
cagaataactcattctcggatgcatcagaactaggcaaacgaagggcaaggaaagaaggg
aatgaatataagatgatgcagaacagaagaaatacgtatacagttcaaaacaacacaggt
ccctacttcaatccccgctcacgccagaggattccccgggatctggccatgtgcgtcacc
cccagcggccagttctactgctccatgtgcaatgcgggggccagcgaggagatggagttc
agacagcacttagaaagcaaacagcataaaagcaaggtgtccgaacagcggtataggaat
gagatggagaacctcggctacgtacaatga

DBGET integrated database retrieval system