KEGG   Columba livia (rock pigeon): 102084345
Entry
102084345         CDS       T02912                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102084345 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 102084345
NCBI-ProteinID: XP_005503575
UniProt: A0A2I0MA44
LinkDB
Position
Unknown
AA seq 295 aa
MIETLVTTEAQELLYQLTALLEQELRCQPKASGLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFHTETFSLAVNFLDRFLSKMKVQPKHLGCVGLSCFYLAVKASEEERNVPLATD
LIRISQYRFTVSDMMRMEKIVLEKLCWKVKATTAFQFLQLYHSLIHENLSSERRKYLNFE
RLETQLKACHCRIMFSKAKPSVLALSIVALEIEEQKLLELAEALEFLQLHSKINNRDLTF
WKELVLKCLTEYSSSKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPETSS
NT seq 888 nt   +upstreamnt  +downstreamnt
atgattgaaacacttgtaactacggaggcccaggaactgctgtaccagctcacagccctg
ttggaacaggagttaagatgtcagccaaaggcctctggcctgagactcattgaatctgct
cacgataatggcctcagaatgactgcaaggctgcgagactttgaagtgaaagatctcctc
agcttaactcagttctttggcttccatacagagacattttcactagctgtgaatttctta
gataggttcttgtcaaaaatgaaggtacagcctaaacacttgggctgtgttggactcagc
tgcttctacttggctgtgaaggcatcagaagaagagagaaatgttcccttagccaccgac
ttaattcgaataagccagtataggttcactgtttctgatatgatgagaatggagaaaata
gtgttggagaagctgtgttggaaagtcaaagctacaacagccttccagtttctacaacta
tatcattcactcattcatgaaaatttaagcagtgaaaggagaaaataccttaattttgag
agacttgagacgcagcttaaggcatgtcactgcagaatcatgttttctaaagccaagcct
tctgtcttggcactgtctattgtggcactagaaatagaagaacaaaaactactggagttg
gctgaggcattggaatttctgcagttgcattccaagataaataacagagatttgaccttc
tggaaggaactggtgttaaagtgccttacagaatattcctcaagcaagtgttccaaacca
aatgtccagaaactaaaatggattgtgtctggacgtacagcacggcagcttaaacatagc
tactacagaataacacatctccctacaattccagagaccagctcataa

KEGG   Columba livia (rock pigeon): 102091922
Entry
102091922         CDS       T02912                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin-G2
  KO
K10146  cyclin G2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04068  FoxO signaling pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102091922 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102091922 (CCNG2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 102091922
NCBI-ProteinID: XP_005504353
UniProt: A0A2I0LR21
LinkDB
Position
Unknown
AA seq 338 aa
MSSEALWLFKQLNLHLELEGRFQPREKGLSLIERAAENENTLCPRQRNVKVEDLWSLTNF
FGFATETFVLAVNILDRFLALMKVKPKHLSCIGVCCFQLAARVVEEECNIPSAQEIIRIS
QCKCTVSDLKRMEKIISEKLHFEFKATTALTFLHLYHTIVLCHTSERKEVLNLDKLEAQL
KACNCRLVFSKAKPSVLALCLLTLEVETLKSVELFEILLRVQKHSKISDSDLLYWRELVS
KCLADYSSPECCKPDHTKLVWIVSRRTAQNLQNSYYSVPELPTIPEGGCFNESESEDSCE
DMSSGEDSLSSSPPSDLEGTFFFELEPKTKWQTLNCRS
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgagcagcgaggcgctttggctgttcaagcagctgaacctgcacctggagctggagggg
cggttccagccccgggagaaggggctcagcctcatcgaacgcgccgccgagaatgaaaac
actctgtgtccgagacagaggaacgtgaaggtggaagatctttggagtctgaccaacttc
tttgggtttgcaactgaaacgtttgttttggctgtcaacattctggacagattcctggct
cttatgaaggtgaaaccgaagcatttgtcttgcatcggagtttgttgtttccagctggcc
gcgcgagtagtggaggaagaatgcaatattccgtctgctcaggagatcatccggattagc
caatgcaaatgcactgtgtctgacctgaaacggatggaaaagatcatttcagaaaagttg
cactttgaatttaaagctactactgccttaaccttcttgcacttgtaccatactattgta
ctctgtcatacctcagaaaggaaagaagtcttgaatcttgataaattggaagcacagcta
aaagcttgcaactgtcgtctagtcttctctaaagccaaaccgtctgtcttggccttgtgc
ctcctcaccctggaggttgagacgctgaaatctgtggagctgtttgagatccttctgcgt
gttcagaagcattctaagataagtgatagtgacctgctctactggagggaactggtctca
aaatgcctagcagattattcttctccggaatgttgcaagcctgatcatacaaagctagtt
tggattgtttcgagacgtacagcccagaatctccagaacagttactacagtgttcctgag
ctgccaaccataccagagggtggatgtttcaatgaaagcgagagtgaggactcctgtgaa
gacatgagcagcggagaagacagcctgagcagctctcctcccagcgatctggaaggcacc
ttcttctttgaactcgaacctaaaaccaagtggcaaactcttaactgtcggtcttag

DBGET integrated database retrieval system