KEGG   Columba livia (rock pigeon): 102084552
Entry
102084552         CDS       T02912                                 

Definition
(RefSeq) calpain-2 catalytic subunit
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04141  Protein processing in endoplasmic reticulum
clv04210  Apoptosis
clv04217  Necroptosis
clv04218  Cellular senescence
clv04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102084552
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102084552
   04217 Necroptosis
    102084552
   04218 Cellular senescence
    102084552
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102084552
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     102084552
Peptidases and inhibitors [BR:clv01002]
 Cysteine peptidases
  Family C2: calpain family
   102084552
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7
Other DBs
NCBI-GeneID: 102084552
NCBI-ProteinID: XP_005511543
LinkDB
Position
Unknown
AA seq 693 aa
MGARTGTDAEPMRCPAASETCFPVGPRRTEVDALGEGESSSVTRRGFPAGPTALGYRELG
PSSYKTQGVVWRRPTELCSSPQFIAGGATRTDICQGALGDCWLLAAIASLTLNEEILARV
VPKDQSFQDEYAGIFHFQFWQYGEWVDVVVDDRLPTKNGELLFVHSAEGSEFWSALLEKA
YAKLNGSYESLSGGTTTEGFEDFTGGIAEWYELQKAPPNLFRIIQKALQKGSLLGCSIDI
TSAAETEAVTSQKLVKGHAYSVTGAEEVNFRGTVQKLIRIRNPWGEVEWTGKWNDNCPNW
SGVDPEVREQLTRRHEDGEFWMAYNDFLRHYSRLEICNLTPDTLASDRYKKWSLMKLDGN
WRRGATAGGCRNYPNTFWTNPQYLIKLEEEDEDPDDPERGCTFIIGLIQKHRRRQRKMGE
DMHTIGFAIYEVPPEFSGQTNIHLSKNFFLTNKARERSXXXXXXXXXXXXPAGEYIIVPS
TFEPNKNGDFCLRVFSEKNANSTVIDDEIEADFEETDISEDDIEPNFKKLFAQLAGSDAE
ISAFELRNILNKVMAKRQDIKSDGFSIETCKIMVDLLDNDGSGKLGLKEFHTLWTKIQKY
QKVYREIDVDRSGTMNSYEMRRALEAAGFKLNCKLHQVIVARFADEDLIIDFDNFVRCLI
RLETLFKMFRKLDTEKTGTIELNLVNWLCFTVI
NT seq 2082 nt   +upstreamnt  +downstreamnt
atgggagctaggactggcacagatgcagagcccatgaggtgcccagctgcgagcgagacg
tgcttccctgtgggtccacggcgaacagaggtggacgctttgggggagggggaatcttca
tccgtgacgcggagagggttccccgccggccccaccgcccttggctaccgagagctgggg
cccagctcctacaagacgcagggcgtcgtctggcgcagacccacggagctgtgttccagc
ccacagttcatagccggtggagccactcgcacagacatctgccaaggggccttaggggac
tgttggctcttggctgctattgcctctctaaccctgaatgaagaaattctggcccgtgtc
gttcccaaagaccagagcttccaggatgaatatgcaggaattttccacttccagttctgg
cagtacggggagtgggtggatgtcgtggtggatgacaggctgcccaccaagaatggggag
ctgctcttcgtgcactcggcggagggcagtgagttttggagtgcgctgctggagaaggcc
tatgccaagctgaacggctcgtatgagtctctctctggtggcaccaccactgaaggtttc
gaggacttcactggtggtattgcagaatggtatgagctgcagaaggcaccacccaacctc
ttcagaataattcagaaggcacttcagaaaggctctctccttggctgctccattgacatc
accagtgcagcggagacggaggcagtcacttcccaaaagctggtgaaggggcacgcgtat
tcggtcaccggggcagaggaggtgaacttccgaggaacagtgcagaagctgatcagaatc
cgaaatccctggggggaagtggagtggactgggaaatggaatgacaactgtccaaactgg
agtggtgttgatcctgaggtgcgggagcagctgactaggagacatgaagatggggaattt
tggatggcgtacaatgacttcttgagacattactcccgcctggagatctgcaacctgacg
ccagataccctggcaagtgacaggtacaagaagtggagcctgatgaagctggatgggaac
tggaggcgtggagccactgcaggggggtgcaggaattacccaaacactttctggacaaat
ccacagtatttaatcaagctggaggaagaagatgaggatcctgatgatcctgagagaggc
tgcactttcatcattggcctgattcagaagcaccggcggaggcagaggaagatgggagag
gacatgcacaccattggctttgcgatttatgaggtgcccccagagttttctggccagacg
aatattcatctgagcaaaaactttttcctgaccaacaaagcgagagaaagatcgnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnntccctgcaggagaatatatcattgtaccctca
accttcgaacccaacaagaatggggatttctgtctgagagtcttctctgaaaaaaacgca
aactccacggttatagatgatgaaattgaggccgattttgaagagactgacatcagtgaa
gacgacattgaacccaactttaaaaagctttttgcacagctagcaggaagtgatgcagag
atctctgccttcgaactgcgcaacatcttgaataaagtcatggctaaacgccaagatatt
aaatctgatggctttagtattgagacatgcaaaataatggttgacctgttagataatgat
gggagcggtaaactgggactgaaggaattccacaccctctggacaaagattcagaaatac
cagaaagtttacagggaaattgatgtggatcgatctggtaccatgaattcgtatgagatg
aggagagcgctggaagcagcagggttcaagttgaactgcaagttacatcaggtcattgtg
gctcgctttgctgatgaagacctcataattgactttgataactttgtccggtgtttgatt
cggctggaaaccctgttcaaaatgtttagaaaactggatactgaaaaaactggaacaata
gaattgaacctcgttaattggctgtgctttactgtcatttga

DBGET integrated database retrieval system