KEGG   Columba livia (rock pigeon): 102084608
Entry
102084608         CDS       T02912                                 

Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04217  Necroptosis
clv04620  Toll-like receptor signaling pathway
clv04621  NOD-like receptor signaling pathway
clv04622  RIG-I-like receptor signaling pathway
clv04625  C-type lectin receptor signaling pathway
clv05132  Salmonella infection
clv05164  Influenza A
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102084608
   04217 Necroptosis
    102084608
   04115 p53 signaling pathway
    102084608
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102084608
   04621 NOD-like receptor signaling pathway
    102084608
   04622 RIG-I-like receptor signaling pathway
    102084608
   04625 C-type lectin receptor signaling pathway
    102084608
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102084608
  09172 Infectious disease: viral
   05164 Influenza A
    102084608
   05168 Herpes simplex virus 1 infection
    102084608
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clv01002]
    102084608
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102084608
Peptidases and inhibitors [BR:clv01002]
 Cysteine peptidases
  Family C14: caspase family
   102084608
SSDB
Motif
Pfam: Peptidase_C14 DED PYRIN YihI
Other DBs
NCBI-GeneID: 102084608
NCBI-ProteinID: XP_021155179
LinkDB
Position
Unknown
AA seq 464 aa
MELPRQRLLALSEELDGAELAALKFLSLEHVPMRKLEGVRRAQDLLEVLQEKGMLEAENL
SFLRELLYRIGRMDLLARLGCSREEMDRELRIPDRAQVSPYRYLLFQLSEDITKDELNSF
KFLLGEELPKCKLNPKTTMLDLFIEMEKKRILAEDNLSILKHLCAEINVSLLKRIEEYEL
NIVGEEAMTITEEGRCSTGDPEAHGRWPASPMALDCPANWNEPSQLEAYKMSSRPRGVCL
ILNNHSFAKAREAAPELRDMKDRNGTHMDAEALGRVFSKLHFTVAEYKDLTAEEIRKIVN
LFRCEDHKDRDCFVCCVLSHGKKGIIYGVDGQEVPIQELTTSFTGHNCPSLAGKPKVFFI
QACQGDACQKGVTIETDSLETDARFQLECIPAEADFLLGMATLQDYVSYRNPRQGTWYIQ
ALCQHLESSCPRGEDILTILTAVNKKLMPQPSFTLRKRLVFPVN
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggagctgccccggcagcggctgctggcgctcagcgaggagctggacggcgccgagctg
gcggctctcaagttcctcagcctggagcacgtccccatgaggaagctggaaggcgtccgg
agggcgcaagacttgctggaggtgctgcaggagaaggggatgctggaggcggagaacctc
tccttcctcagggagctgctctaccgcatcggccgcatggacctgctggcccggctgggc
tgcagccgcgaggagatggacagagagctccgcatcccggacagggcacaggtgtcgccg
taccgatacctgctcttccagctgtcagaagacatcactaaagatgagctgaactccttt
aagtttcttctgggggaagaattaccaaaatgcaagctgaaccccaagacaacaatgctc
gacctgttcattgagatggagaagaagcggattttagcagaagacaacctgagtatcctg
aagcatctctgtgcagaaattaacgtcagcctgttgaagagaattgaagagtatgaatta
aacatagtcggtgaagaagcgatgaccatcacagaggaagggaggtgcagcacaggagat
ccagaagcccatggcagatggccggcgtcacctatggcactggattgtcctgccaactgg
aatgagccgtcccagcttgaagcttacaagatgagcagccgcccccgtggggtgtgcctg
atcctgaataaccacagctttgcaaaagccagggaagcagcgccagaactccgagacatg
aaggatcggaatggcacccacatggacgcagaggctctgggaagagtcttcagcaagctg
cattttacagtcgcagaatataaagacctcactgccgaagaaatccgtaagattgtgaac
ttgttccggtgcgaagaccacaaggacagagactgttttgtttgctgtgtcctgtctcat
gggaaaaaaggcattatttacggagtcgatgggcaggaggtgccgatccaggagctcacc
acgtctttcactggacacaattgcccctcgcttgctggaaaacccaaagtctttttcatt
caggcctgccaaggcgatgcttgccagaaaggtgtgaccattgaaacggattccctagaa
acagacgcgagatttcagctggagtgcatccccgccgaggcagatttcctcctgggcatg
gccaccctgcaagattacgtgtcctacaggaacccgcggcaggggacctggtacatccag
gccttgtgccagcacctggagtccagctgtcctcgaggagaagatattctcaccatcctg
acagcggtgaataaaaagctgatgccacagcccagtttcacgctgaggaaaagactcgtc
tttcccgtcaactaa

KEGG   Columba livia (rock pigeon): 102084797
Entry
102084797         CDS       T02912                                 

Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04217  Necroptosis
clv04620  Toll-like receptor signaling pathway
clv04621  NOD-like receptor signaling pathway
clv04622  RIG-I-like receptor signaling pathway
clv04625  C-type lectin receptor signaling pathway
clv05132  Salmonella infection
clv05164  Influenza A
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102084797
   04217 Necroptosis
    102084797
   04115 p53 signaling pathway
    102084797
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102084797
   04621 NOD-like receptor signaling pathway
    102084797
   04622 RIG-I-like receptor signaling pathway
    102084797
   04625 C-type lectin receptor signaling pathway
    102084797
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102084797
  09172 Infectious disease: viral
   05164 Influenza A
    102084797
   05168 Herpes simplex virus 1 infection
    102084797
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:clv01002]
    102084797
Enzymes [BR:clv01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     102084797
Peptidases and inhibitors [BR:clv01002]
 Cysteine peptidases
  Family C14: caspase family
   102084797
SSDB
Motif
Pfam: DED Peptidase_C14
Other DBs
NCBI-GeneID: 102084797
NCBI-ProteinID: XP_021155180
LinkDB
Position
Unknown
AA seq 455 aa
MNTDFHKLLFDISEALVADELEALKFLSLDYIPRRRLEAIREPKAFFEVLQEKGMLEAEN
LSFLRELLYRIGRMDLLARLGCSREEMDRELRIPDRAQVSAHRLLLYGIAEDLTADDVAS
VKFLLQEQIPKNKLQENASLLKVLLEMEKKRIIKEDDLATLKDILKKVRPDVKKKIDAYE
ERKQEDNSKEKLHHPVPVHAAEQGAEQQTAQPLVESYKMKNNPHGYCVILNNYKFRNLSQ
PREGTRKDGEAVKEVFTWLQFETVEHMDLGAEQIRAKVEEYSKKDHSNMDCFVCFILSHG
EKDKVKGVDDELVNIKDLLSCFSGSNCPSLVGKPKLFFIQACQGSVGHPPVTVREDFSGH
LQTDAVPPTSIPDQADILVGMATVEDYECYRDVTTGSVYIQCLCEKMKLLCPLRKDLVTI
LTEVNKEVGSRVFEGRKQMPKITSTLRKQLIFQIP
NT seq 1368 nt   +upstreamnt  +downstreamnt
atgaatacagacttccacaaactcctttttgacatttctgaggctttggtcgcagatgaa
ctggaggctctcaagttcctcagcctagactacattcctaggaggaggctggaagccatt
cgggagcccaaggcctttttcgaggtgctgcaggagaaggggatgctggaggcggagaac
ctctccttcctcagggagctgctctaccgcatcggccgcatggacctgctggcccggctg
ggctgcagccgcgaggagatggacagagagctccgcatcccggacagggcacaggtgtcg
gcccacaggctactgctgtatggaattgcagaggacttgactgcagacgatgttgcgtcc
gtgaagttcctgctccaagaacaaataccaaagaacaagctccaggagaatgcttccttg
ttgaaggtcttattggaaatggaaaaaaaaaggataattaaagaagatgacctggcaacg
ctgaaagatatattaaagaaagttagacctgatgtaaagaagaaaattgatgcctacgaa
gaaagaaaacaagaagacaattctaaggaaaaactccaccatccagtgcctgtgcatgca
gcagaacaaggagcagagcagcagacagcacaaccgcttgtggagtcatataagatgaaa
aataacccccatggttactgtgtgattcttaacaactacaaatttagaaatctgtctcaa
cccagagaaggaacacggaaagatggagaggctgtaaaggaggtctttacgtggcttcag
tttgagacagttgagcacatggatctaggagcagaacaaatacgtgcaaaagttgaagaa
tacagtaaaaaagaccatagtaacatggactgtttcgtttgcttcattttgtcccatggt
gaaaaagacaaagtaaaaggcgttgatgatgaacttgtaaatattaaagatttactctcc
tgcttcagtggatccaattgtccttctctcgttggcaaacccaagctgtttttcatccag
gcttgccaaggctctgtcggtcatccgcctgtcacagtgagagaagatttttctggacat
cttcagacagatgctgtccctccaacttccatccccgatcaggccgatattctggttggc
atggctacagtggaagactacgagtgctaccgcgacgtaaccacgggcagcgtttacatt
cagtgcctctgtgaaaagatgaagttgctttgcccactccgcaaggatctcgtaaccatc
ctgacagaagtgaacaaggaagtgggcagcagagtatttgaaggacggaagcagatgcca
aagataacatccaccctacgaaagcaattgatcttccaaattccataa

DBGET integrated database retrieval system