KEGG   Columba livia (rock pigeon): 102084706Help
Entry
102084706         CDS       T02912                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00052  Galactose metabolism
clv00500  Starch and sucrose metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102084706 (GANC)
   00500 Starch and sucrose metabolism
    102084706 (GANC)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102084706 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110 NtCtMGAM_N POC3_POC4
Motif
Other DBs
NCBI-GeneID: 102084706
NCBI-ProteinID: XP_021143211
LinkDB All DBs
Position
Unknown
AA seq 936 aa AA seqDB search
MKVNAKSGASLTGFSSHASPPLQPTLKDGLRAFSLSALSSVQDEAVDKSTFKECNQIAFY
RRQKLLHPGKSLYQALLDSVTLSDENVKFPIIHEENKVLLQVEICEIEGSIFRLKIDEAA
PLRERYKVPDVLIKEPVTRRLIISQKEAGILVLSNVNEDYKLQVTANPFQIELQSKTETV
LSMNSNGLLYFEHLQPPPSDRKHTEENKDESSSDSSKEKQEDLGLWQEKFGRFLDIKAHG
PSSVGVDFTLHGFEHVYGLPQHAEALLLKNTSDGDAYRLYNLDIFGHKIHDKIGIYGSVP
LLLAHKPNRTSGIFWLNSSETLVDINTKAVAEHILSGSAAETAKQRAVPVTDVRWMSESG
XXXXXIFKQFAHLTGTQALPPLFSLGYHQCRWNYEDEQDVKAVDAGFDQHDIPYDVIWLD
IEHTDGKRYFTWDKKKFRNPRKMQEHLKKRKRKLVVIVDPHIKVDPTYTLYSQAKDKGYF
VKDRNGQDFEGICWPGSSCYLDFTNPEVRKWYADQFAFKTYKGSTNILFAWNDMNEPSVF
KGAELTMPKDAVHYNNWEHREVHNLYGFYQQMATAEGLIRRSSGKERPFVLTRSFFAGSQ
KYGAVWTGDNTAEWRYLKISIPMLLTISMAGISFCGADVGGFIGDPEPELLVRWYQAGAY
QPFFRGHSNMESKRREPWLFGEKNTQIIREAIRERYVLLPYLYTLFYRAHTAAEPVMRPL
WIEFPGKIETFGVDNEYMLGNALLVHPVTEPEAKAVSVLLPGSEEIWYDFRKFKRMEDPG
TLKIPVTLENIPVFQRGGTVLPLKTTAGKSTEWMTDISYELHVALDTEACAIGELYLDDG
HSFQYLHKKQFLYRKFTFHKNILSSSCIDESGRYHTTCVVARVIVLGFGQQPTLVTASSK
GGKEKEVVFTYDTKTSMLMLENLALSVDADWRIHIS
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgaatgccaaatcaggagccagccttactggattttccagtcatgcttcacca
ccccttcaacctactcttaaagatggcttgagagcattttctttatctgctctttctagt
gtccaagatgaggctgtggacaaaagcaccttcaaggaatgcaaccagattgctttctac
aggcgtcagaaacttctacatcctggaaaatccttgtatcaagcattgttggattcagtc
acattaagtgatgagaatgtcaaattccctattattcatgaggagaataaggttcttcta
caagtagaaatttgtgaaatagaaggcagtattttcaggcttaaaattgatgaggcagct
cctctcagagaaagatacaaagttcctgatgttcttataaaggaacctgtcacccgaaga
cttatcatatcccagaaggaggcaggcattttggtgctgtcaaatgttaatgaggactac
aaacttcaagtcacagcaaaccccttccagattgagctacagtccaagaccgagactgtt
ctgagtatgaattccaatgggttgttatattttgagcacctacaaccacctcccagtgat
agaaaacatacagaagaaaacaaggatgagtcatcaagtgattcctctaaggagaaacaa
gaggatctaggtctctggcaagagaaatttggcagattcttagacatcaaagctcatggt
cctagttctgtaggtgtggacttcactttacatggatttgagcatgtttatggactacca
caacatgcagaagcacttcttctcaaaaacaccagtgatggtgatgcctaccggctttat
aatttggatatcttcggccacaagatacatgacaaaataggcatttatggttcagtgccc
cttctcttagcacacaagcccaacagaacttcagggatcttctggctgaactcttcagaa
acgctggtggatattaatacaaaggcagtagctgagcacatcctgtccggatctgctgca
gagaccgccaagcagagagccgtgcctgtaactgatgtgcgctggatgtcagaaagcggt
annnnnnnnnnnnatatcttcaagcagtttgcacatctgacaggcactcaggccctgccc
ccacttttttctctgggctaccatcagtgccgctggaattacgaggatgagcaagatgtc
aaggcagtagacgctggctttgatcaacatgacattccttatgatgtgatatggctggac
atagagcacacagatggcaagaggtattttacttgggacaaaaagaaattccgaaacccc
agaaagatgcaagaacatctcaagaagagaaaacggaagcttgtcgtcattgtagatccc
cacattaaggttgatcccacctataccctgtattcacaggcaaaggacaaaggatatttt
gtgaaagacagaaatgggcaagattttgagggcatctgttggccaggttcctcttgttac
ctggatttcaccaaccctgaagtgcgaaagtggtatgcagatcaatttgccttcaaaaca
tacaagggatccactaatatcctctttgcgtggaatgacatgaatgagccttcagtcttc
aaaggggcagaactaacaatgccgaaagatgctgtccactacaacaactgggagcatcgg
gaagtacacaacctctacggattctaccagcaaatggcaactgcagaaggactcatcaga
cgttcttcaggaaaagagagaccatttgtcctcacacgatctttctttgctggttcacag
aagtatggggcagtgtggactggagacaacacagcagagtggcgttacttgaaaatatct
attccaatgcttctcaccatcagcatggcagggatttcattctgtggagctgatgtggga
gggtttattggagatccagagccagaattacttgttcgctggtatcaggctggagcctac
cagcccttcttcagaggtcattctaacatggagagcaaacggcgagaaccgtggctcttt
ggggagaagaacacccagatcatcagggaagccattagagagcgctacgtcctcctgcca
tacttatacacactgttctatcgggcacacacagcggctgaaccggttatgaggcctctc
tggatagagtttccagggaaaatagaaacttttggcgtggataatgagtacatgctggga
aatgctttgttggtgcatccagtcacagagccagaggccaaggcagtgagtgttctgctt
ccagggtcagaggagatttggtatgatttcagaaaatttaaacgaatggaagatccaggc
actctgaagatcccagtaacactggagaatattcctgtgttccagcgggggggcactgtg
ttgcccctgaagaccacggctggaaaatcgactgaatggatgacagatatttcttatgaa
ctccacgtggccctggacacagaggcctgtgcaatcggtgagctctacctggacgatggg
cattcctttcagtatctacacaagaagcagttcctgtatcggaaattcactttccacaag
aacattctctcttccagctgcatagatgaaagcggacgataccacactacgtgtgtggtt
gcacgagtgatagttctgggatttggacagcaacccactcttgtaacagcttcttccaag
ggtggaaaagaaaaagaagtggttttcacatatgatacgaagacctccatgctgatgctg
gaaaatctagccctgagtgttgatgctgactggaggattcacatcagctga

DBGET integrated database retrieval system