KEGG   Columba livia (rock pigeon): 102084868Help
Entry
102084868         CDS       T02912                                 

Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    102084868
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     102084868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Patatin cNMP_binding
Motif
Other DBs
NCBI-GeneID: 102084868
NCBI-ProteinID: XP_021155594
LinkDB All DBs
Position
Unknown
AA seq 686 aa AA seqDB search
MTFTAATGLSLHCCKMQARSFGENLEYDSLPSLQKVEALTHQPRATTVHAVRDSELAKLP
EGALTCIKRKFPQVVTRLIHLLGEKILGSLQQGAVYPLGLHSSSKWDAGNPASNLSTVAI
MPVSEEVPLTAFTLELKHALSAVGPTLLLTSDNIKQRLGSAALDSLHEYRLTSWLGQQED
IHRIVLYQADSTLTPWTQRCIRQADCILIVGLGDQEPTVGELEKMLESTAVRAQKQLILL
HKEDGPLPSRTVEWLNMRSWCSGHLHLHCPRRVFSKRSLPKLIEMYDRVCQKPPDRHSDF
SRLARVLTGNAIALVLGGGGARGCSQVGVIRALTEAGIPIDMIGGTSIGAFMAALYAEER
NYNQMRIKAQQWCMVVNSLFKNFLDLTYPITSMFSGASFNKSISNIFKDKQIELIPAGSL
WRYIRASMSLSGYMPPLCDPKDGHLLMDGGYINNLPADVARSLGAKVVIAIDVGSQYETD
LVNYGDCLSGWWLLWKKWNPLAKKVKVLNMAEIQTRLAYVCCVRQLEMVKSSDYCEYIRP
PIDRYRTLDFKKFEEICEVGYQHGKTIFSVWCRSGVLDTMMTDRTWTCKSKTDNVASPTT
SFTDLAEIVSRIEPVKAPVADDESDYQTEYEEEVLDNQKDDYINFIRTQADDNSDSDEEV
QIRQRRNVPSVDDQASSTYEISSCEP
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcactgctgcgacaggactgtcactgcactgctgcaaaatgcaggctcggtcc
tttggggagaacctggagtatgactcactgccttccttacaaaaggtagaggcgctaacc
caccagcccagagccaccactgtacacgccgtcagggactcggagctcgccaaactcccc
gagggagcactgacctgtatcaagcgcaaattcccccaggttgtgaccagactgatccac
ttgctgggcgagaagatcctgggcagcctgcagcagggagcagtttaccctctcggattg
cacagctcgagcaagtgggacgcgggcaatcctgccagcaacctgtccaccgtagccatc
atgccggtgtccgaggaggtgccgcttacggcttttaccctggagctcaagcatgcgctc
agcgctgttggtcctactttgctgctcaccagtgacaacatcaaacagcgactcggttct
gctgcactggacagtctccacgaataccggctgaccagctggctgggccagcaggaggac
atccaccgcatcgtgctgtaccaggcagacagcaccctgaccccctggacccagcgctgc
atccgacaggccgactgcatcctcattgtggggctgggcgaccaggagcccaccgtgggc
gagctggagaagatgctggagagcacggcggtgcgagcgcagaagcagctgatcctgctc
cacaaggaggacgggcctctcccttcccgcaccgtggagtggctcaacatgcgcagctgg
tgttctggtcacctccacctgcactgtccgcgcagagtcttctccaaaagaagcctgccc
aagctgatagagatgtacgaccgcgtgtgccagaaaccacccgaccgacactccgacttt
tctcgcctggctcgtgttctgaccggcaatgccattgcgctggtgctcggcggcggagga
gcgagaggatgctcccaagtgggagttatcagggcgctgacggaagccggcatccccata
gacatgatcggaggaacatccatcggtgcttttatggccgccttgtacgccgaagaacgc
aactacaaccagatgcgcatcaaagcccagcagtggtgcatggtcgtgaactcactgttt
aagaactttctagacttgacatatcctataacctctatgttttctggagcgtcttttaac
aaaagcatcagcaacatcttcaaagacaagcagatcgagctcattcccgcaggctccctg
tggaggtacatccgtgccagcatgtccctttcggggtacatgcctcccctctgtgacccc
aaggacgggcatctcttgatggatggaggttatatcaacaacctaccggctgacgtcgcg
aggtccctgggcgcaaaggtggtgatcgccatcgacgtggggagccagtatgagacagac
cttgtcaactacggcgactgcttgtccggctggtggctgctctggaagaagtggaatcca
ctggccaagaaagtcaaggtgctgaacatggcagagatccagacgcggctggcgtacgtg
tgctgtgtgcggcagctggagatggtgaagagcagcgattactgcgagtatatccgcccg
cccatcgaccggtaccggaccctggactttaagaaattcgaagaaatctgtgaagtggga
tatcagcacgggaaaactatatttagtgtctggtgcaggagtggagtgcttgacacgatg
atgacagacaggacttggacttgcaaatccaaaaccgataacgtggcctctcccaccacc
tcttttacggacctggcagaaatcgtctcccggatcgagcccgtgaaggcgcccgtggca
gacgatgagtcagactaccagactgagtacgaggaagaagttctggacaaccaaaaggat
gattacatcaatttcataaggacccaggctgacgacaactccgactcggatgaagaggtg
cagataagacagcgcaggaacgtccccagcgtggacgaccaggcgagcagcacctacgaa
atcagttcatgtgaaccgtaa

DBGET integrated database retrieval system