KEGG   Columba livia (rock pigeon): 102084879
Entry
102084879         CDS       T02912                                 

Gene name
MAPK1
Definition
(RefSeq) mitogen-activated protein kinase 1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04012  ErbB signaling pathway
clv04068  FoxO signaling pathway
clv04114  Oocyte meiosis
clv04140  Autophagy - animal
clv04150  mTOR signaling pathway
clv04210  Apoptosis
clv04218  Cellular senescence
clv04261  Adrenergic signaling in cardiomyocytes
clv04270  Vascular smooth muscle contraction
clv04350  TGF-beta signaling pathway
clv04370  VEGF signaling pathway
clv04371  Apelin signaling pathway
clv04510  Focal adhesion
clv04520  Adherens junction
clv04540  Gap junction
clv04620  Toll-like receptor signaling pathway
clv04621  NOD-like receptor signaling pathway
clv04625  C-type lectin receptor signaling pathway
clv04810  Regulation of actin cytoskeleton
clv04910  Insulin signaling pathway
clv04912  GnRH signaling pathway
clv04914  Progesterone-mediated oocyte maturation
clv04916  Melanogenesis
clv05132  Salmonella infection
clv05164  Influenza A
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102084879 (MAPK1)
   04012 ErbB signaling pathway
    102084879 (MAPK1)
   04350 TGF-beta signaling pathway
    102084879 (MAPK1)
   04370 VEGF signaling pathway
    102084879 (MAPK1)
   04371 Apelin signaling pathway
    102084879 (MAPK1)
   04068 FoxO signaling pathway
    102084879 (MAPK1)
   04150 mTOR signaling pathway
    102084879 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102084879 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    102084879 (MAPK1)
   04210 Apoptosis
    102084879 (MAPK1)
   04218 Cellular senescence
    102084879 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102084879 (MAPK1)
   04520 Adherens junction
    102084879 (MAPK1)
   04540 Gap junction
    102084879 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102084879 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102084879 (MAPK1)
   04621 NOD-like receptor signaling pathway
    102084879 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    102084879 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102084879 (MAPK1)
   04912 GnRH signaling pathway
    102084879 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    102084879 (MAPK1)
   04916 Melanogenesis
    102084879 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102084879 (MAPK1)
   04270 Vascular smooth muscle contraction
    102084879 (MAPK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102084879 (MAPK1)
  09172 Infectious disease: viral
   05164 Influenza A
    102084879 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102084879 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clv03036]
    102084879 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clv04147]
    102084879 (MAPK1)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     102084879 (MAPK1)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   102084879 (MAPK1)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     102084879 (MAPK1)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102084879 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH FTA2 Choline_kinase Kdo
Other DBs
NCBI-GeneID: 102084879
NCBI-ProteinID: XP_013226924
UniProt: A0A2I0M868
LinkDB
Position
Unknown
AA seq 397 aa
MTRKSDGTKPERLGLPALSPGRGSSISASLSSTLLFPPCSRGLSLRHPLSAPSLPPPPAS
KIPPSLGAAQRLVSFQPSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENI
IGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSA
NVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSK
GYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNY
LLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEP
VAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgacccgtaaatcggatggcaccaaacccgagaggctgggcctgcctgccctgagccct
ggccggggctccagcatctctgcctcgctctcctcaactctgcttttccctccgtgctcc
cgaggcttgtccctccggcatcccctttctgctccctcgctgccgcctccccccgcttcc
aaaattcctccatccttgggtgcagctcaacgtctcgtttcctttcagccttctgcctat
gataacgtcaacaaagttcgagttgctataaagaaaatcagtccttttgagcatcagacg
tactgccagagaactctgagagagattaagatcctactgcgcttcagacatgagaatatt
attggaataaatgacattatccgagctccaactattgaacaaatgaaagatgtatacatt
gtgcaagatcttatggagacagatctttacaagctcttaaagactcaacacctcagcaac
gaccacatttgttatttcctttaccagattctgagagggttaaaatatatccattcagcc
aatgtgcttcatcgtgacctcaaaccttcgaatttgctgcttaacaccacttgtgatctc
aagatttgtgactttggactggctcgtgttgcagatccagatcatgatcacacaggattc
ttgacagaatacgtggccacgcgttggtacagggctcctgaaatcatgctgaattctaag
ggttacaccaagtctattgacatctggtcagtaggctgtattctggcagagatgctctcc
aacagacccatctttccaggaaaacactaccttgaccaacttaaccacatcctcggtata
cttggatccccttcccaagaagatttgaattgtataataaatttaaaggccagaaactac
ttgctttctctaccacacaaaaataaggtaccatggaacaggctgtttccaaacgctgac
cccaaagcacttgatttgttggataaaatgttgacctttaatcctcacaagcggattgaa
gtggagcaagctttagcccatccatatctggagcagtattatgatccaagtgatgagcct
gtagctgaagcgcccttcaagtttgatatggagttggatgacttgccgaaggaaaagctg
aaagaactgatttttgaggaaactgctagattccagccaggatatcgatcttaa

DBGET integrated database retrieval system