KEGG   Columba livia (rock pigeon): 102084928
Entry
102084928         CDS       T02912                                 

Gene name
CCNB2
Definition
(RefSeq) G2/mitotic-specific cyclin-B2
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04114  Oocyte meiosis
clv04115  p53 signaling pathway
clv04218  Cellular senescence
clv04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102084928 (CCNB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102084928 (CCNB2)
   04114 Oocyte meiosis
    102084928 (CCNB2)
   04115 p53 signaling pathway
    102084928 (CCNB2)
   04218 Cellular senescence
    102084928 (CCNB2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102084928 (CCNB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:clv03032]
    102084928 (CCNB2)
   03036 Chromosome and associated proteins [BR:clv03036]
    102084928 (CCNB2)
DNA replication proteins [BR:clv03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102084928 (CCNB2)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102084928 (CCNB2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102084928
NCBI-ProteinID: XP_005511188
UniProt: A0A2I0M6Y9
LinkDB
Position
Unknown
AA seq 400 aa
MALPVTRRAALTRGMENAVTDLKSKAKTHIPGKRAALEEIGNKVVTRGTHIAKKTEPSKA
SLKPTEGPSKMTKVTVPPKPPAAVNRAFKEIDVPKVLSPVPMDVSMQEEDLCQAFSDVLL
NNIEDIDAEDGGNPQLCSDYVKDIYLYLKDLELQQSIRPHYLDGKTLNGRMRAILVDWLV
QVHSRFQLLQETLYMCVAVMDRFLQSHPVPRKRLQLVGVTALLLASKYEELFCPTVADLV
YITDNSYTSDEIKEMEIVMLKGLNXXXXXXXHFLRRASKAGEADAKQHTLAKYLMELTLT
DYDMVHHRPSEVAAAAICLSQKLLGHNEWGTKQQYYTGYTEDSLVMTMKHMAKNVVKVNE
KLTKYTAIKNKYASSKLLRISTIPQLRGGIIEDLASSLLS
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcgctcccggtgacacgccgtgccgctctcactagagggatggagaatgctgtgact
gaccttaaaagtaaagccaaaactcacattcccggcaaaagggctgctttggaagaaata
ggaaataaagttgtcacaagaggaacacatatagctaagaaaacagaaccctccaaagca
tccctgaagcctacagaaggacctagtaaaatgacaaaagtaactgtaccgcctaaacct
ccagcggctgtgaatcgagcattcaaagaaattgatgttccaaaggttctgtctcctgtc
cctatggatgtatctatgcaagaggaggatttgtgccaagccttctctgatgtattgctc
aacaatatagaagacatcgatgctgaggatggggggaatccccagctgtgcagtgactat
gtaaaagatatctacctgtatctgaaggatcttgagttgcagcaatcgatccgcccacac
taccttgacgggaagaccctcaatgggcgtatgcgtgcaattttagttgactggcttgtc
caggtccactcaagattccagcttttgcaggaaacgctgtatatgtgtgttgcagttatg
gatcgcttcttacagagtcacccagtacctcgtaagaggcttcagctggtgggtgtaaca
gcactgcttctggcttctaaatatgaagagctgttctgccctactgtagcagacttggtt
tacattactgacaattcctataccagtgatgaaattaaagaaatggagattgtgatgctt
aaagggttaaacnnnnnnnnnnnnnnnnnnnnncactttttaagaagagcatcaaaagct
ggggaggctgacgctaagcaacatacactagcaaaatacctaatggagctgacgctgaca
gactatgacatggttcaccatcgtccttcagaggttgcagctgctgcaatatgcttgtcc
caaaagcttctgggacataatgaatggggtacaaagcagcagtactacactgggtataca
gaagacagtcttgtgatgactatgaaacatatggccaagaatgtggtcaaagtaaatgag
aaactaacaaaatacacagctataaagaacaaatatgcaagcagcaaactactgaggatc
agcacaatccctcaactgcgcggcgggataatcgaagacctggcttcatcactcttatca
taa

KEGG   Columba livia (rock pigeon): 102098298
Entry
102098298         CDS       T02912                                 

Gene name
CCNB1
Definition
(RefSeq) LOW QUALITY PROTEIN: G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04114  Oocyte meiosis
clv04115  p53 signaling pathway
clv04218  Cellular senescence
clv04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102098298 (CCNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102098298 (CCNB1)
   04114 Oocyte meiosis
    102098298 (CCNB1)
   04115 p53 signaling pathway
    102098298 (CCNB1)
   04218 Cellular senescence
    102098298 (CCNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102098298 (CCNB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:clv03032]
    102098298 (CCNB1)
   03036 Chromosome and associated proteins [BR:clv03036]
    102098298 (CCNB1)
DNA replication proteins [BR:clv03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    102098298 (CCNB1)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102098298 (CCNB1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102098298
NCBI-ProteinID: XP_021147916
LinkDB
Position
Unknown
AA seq 261 aa
METSGRAPSGDVLCQXFSDVLLDIEDVDVKANADLNSCSSYAKDIYNYLRDLEASQPVRP
KHLDGQKIPGNVRAILIDRIVRAEINLKLQQGTLYMTVAITDRLIQDNAVTKRTLQLVGV
AAMFIVSKYEEILSPAVEDFACVTNHSYTKLQICQMEMKILQALGFCLGHPPPPHFLRRA
SMIAEIPTLQYHMSYTERDLLPVMQHTAKNVILVNEGITQHVAIKKKYSTNKNIEISGSE
ELKSSITQHLAQPLMQELTPL
NT seq 786 nt   +upstreamnt  +downstreamnt
atggagacatctggacgtgccccatcaggtgacgtgctgtgtcagngcttttctgatgtc
ttgcttgatattgaagacgtggatgtgaaagccaacgctgacctgaactcctgcagcagc
tacgcgaaggacatctacaattatctgagagaccttgaggcaagtcagcctgtcagaccc
aaacacctggatggccagaagatccctgggaacgtgcgtgccatactaatagatcggatt
gtgcgagcagaaataaacctcaaactccagcaggggactttgtacatgacagttgctatc
actgatcgcttaatccaggacaatgctgttaccaagaggacattacagctggttggtgtt
gcagctatgtttattgtcagcaaatatgaagagatattgagcccagctgttgaagacttt
gcctgtgtaactaatcacagttacacaaagctccaaatctgccagatggagatgaagatc
ctgcaagccctgggcttctgtctgggtcaccctccccctccacacttcctgaggagggct
tcaatgattgcagagataccaactttgcaataccacatgtcttacacagagagagacctt
ctgccagttatgcagcacacagcaaagaacgtaattcttgtgaatgagggcattacccag
catgtggcaatcaagaaaaaatactccacgaacaaaaacattgagataagtggctctgaa
gagctgaagtcttctatcacacagcatctagcgcaacctttgatgcaagagttaactcct
ctgtga

DBGET integrated database retrieval system