KEGG   Columba livia (rock pigeon): 102085264
Entry
102085264         CDS       T02912                                 

Gene name
MDM2
Definition
(RefSeq) E3 ubiquitin-protein ligase Mdm2 isoform X2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
clv04120  Ubiquitin mediated proteolysis
clv04144  Endocytosis
clv04218  Cellular senescence
clv04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102085264 (MDM2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102085264 (MDM2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102085264 (MDM2)
  09143 Cell growth and death
   04110 Cell cycle
    102085264 (MDM2)
   04115 p53 signaling pathway
    102085264 (MDM2)
   04218 Cellular senescence
    102085264 (MDM2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102085264 (MDM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clv04131]
    102085264 (MDM2)
   04121 Ubiquitin system [BR:clv04121]
    102085264 (MDM2)
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102085264 (MDM2)
Membrane trafficking [BR:clv04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    102085264 (MDM2)
Ubiquitin system [BR:clv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    102085264 (MDM2)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS DZR
Other DBs
NCBI-GeneID: 102085264
NCBI-ProteinID: XP_005502812
UniProt: A0A2I0MKT7
LinkDB
Position
Unknown
AA seq 484 aa
MCNTKMSSLTDASSVTASEQEALVKPKPLLLKLLKLAGAEKDTFTMKEVIFYLGQYIMSK
QLYDEKQQHIVHCANDLLGDLFGVTSFSVKEHRRLYSMISRNLIAINQQGSTLADTPEDD
ARFQLEEENVLKESMQELEEKQTSSNATSRPATSSRRRTHSESEENSSDDLHSDRRKRHK
SDSISLTFDESLSWCVVSGLCRERSNSSDSTDTFSIPDLDASSLSENSDWFDRSSVSDQF
SVEFEVESIYSEDYSHNEEGQELTDEDDEVYQLTIYQDEDSDADSFDEDPEISLADYWKC
PECSEMNPPLPRHCHRCWALREDWLPDEKSDKLVKSKLESSFPLESEEGFDVPDCKTVKM
TEDKEPAVEENEDKAVQISESQESEDYSQPSTSSSMFCSSQEDYKEPEKRELQDKEGSPE
SSLPVTSIEPCVICQSRPKNGCIVHGKTGHLMSCFTCARKLKKRNKPCPVCRQPIQMIVL
TYFS
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgtgcaataccaagatgtcctcccttacggatgcctcttctgtcaccgcttcggagcaa
gaagcgctggttaaaccaaagccactattgttgaagttgttaaagttagctggtgcagaa
aaggacacttttactatgaaggaggtaatattctatcttggacaatatattatgtctaaa
cagttatatgatgaaaaacagcaacatattgtacactgtgcaaatgatctcctgggggat
ttatttggagtaacaagcttttcagtaaaagaacacaggagactgtattcaatgatttcc
agaaatctgatagcaatcaatcaacaaggctctacgcttgcggacacacctgaggatgat
gccagatttcagcttgaagaagaaaatgttctaaaggaatctatgcaagagttagaagag
aagcagacctcctcaaacgcgacttcccgaccagctacatcttctaggaggagaacacac
agtgaatctgaagaaaattcttcagatgatctgcacagtgacagaagaaaacgacacaag
tcagacagcatttcgttgacgtttgatgaaagtctctcatggtgtgtagtcagtggtctg
tgccgtgaaagaagcaatagcagtgattcaacagatactttttccattcccgatcttgat
gccagttcattaagtgaaaactctgattggtttgaccggagttctgtttcagaccagttc
agtgtagagtttgaagttgagtctatttattcagaagattatagccataatgaagaagga
caggagctcacagatgaggatgatgaggtgtatcagctgactatttatcaggatgaagat
agtgatgctgattcgtttgatgaagatccagagatttctctagctgattattggaagtgt
cctgaatgtagcgaaatgaatcctccgcttccacgacattgccacagatgctgggccctt
cgtgaggactggcttcctgatgaaaagagtgataaattggtaaagagcaagttagaaagt
tccttccccctagagtctgaagaaggttttgatgttcctgactgcaagacagtgaaaatg
actgaggataaagaaccagctgtggaggagaatgaggacaaagcagtacaaatatccgag
tcccaggaaagtgaagattattctcagccatcgacatcgagcagcatgttttgtagcagt
caggaggactataaggaacctgagaagagagaactgcaagacaaagagggaagcccggag
tccagtctgcctgttaccagcatcgagccctgtgtcatatgtcagagcagacctaaaaat
ggctgcatagtgcacggcaaaacgggacacctcatgtcgtgttttacatgcgcaagaaag
cttaagaagaggaataaaccctgtccggtgtgcagacagcccatacaaatgattgtacta
acttattttagttag

DBGET integrated database retrieval system