KEGG   Columba livia (rock pigeon): 102085372
Entry
102085372         CDS       T02912                                 

Gene name
CD82
Definition
(RefSeq) CD82 antigen
  KO
K06509  CD82 antigen
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102085372 (CD82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clv04147]
    102085372 (CD82)
   04090 CD molecules [BR:clv04090]
    102085372 (CD82)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102085372 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   102085372 (CD82)
  Exosomal proteins of colorectal cancer cells
   102085372 (CD82)
CD molecules [BR:clv04090]
 Proteins
  102085372 (CD82)
SSDB
Motif
Pfam: Tetraspanin DUF2981 GATase_5 DUF3243
Other DBs
NCBI-GeneID: 102085372
NCBI-ProteinID: XP_005500305
UniProt: A0A2I0MPS1
LinkDB
Position
Unknown
AA seq 265 aa
MGSGCLKVTKYFLFLFNLLFLILGAVILGFGIWILADKTSFIAVLQMSSPSLKTGAYILI
GVGALTMLMGFLGCLGAVNEIRCLLGLYFTCLMVILITQVAAGLVIYFQKETLKDELSHI
VGTLIENYDPLNDDERNLQDAWDYVQTQIACCGWSGAKDWENNKVLINQSMTAYPCSCSN
SSKDFQVDSGFCNLDVPVNGTATYADWPVHEQGCMDGVEEWLKDNLGVILGVCTGVAVIE
LLGMILSISLCKNIHSEDYTKVPKS
NT seq 798 nt   +upstreamnt  +downstreamnt
atgggatctggctgcctaaaagtcaccaagtacttcctcttcctcttcaatctcctgttc
cttatcctgggtgctgtgatccttggctttggaatatggattctggctgacaaaactagt
ttcatcgcagttctgcagatgtcatctccctccctgaagactggtgcatacatcctcatt
ggtgttggggctctgaccatgctgatggggttcctgggctgtcttggagctgtcaatgaa
atccgatgtctcttgggtctgtacttcacctgcctgatggtaattctcataactcaggtt
gctgctggactggtcatctacttccagaaggaaacactgaaagacgagttgtcacacata
gtcggaactctgattgaaaattacgaccctttgaatgatgatgagaggaatttacaagat
gcgtgggactatgtgcaaacacagatcgcctgctgtggctggagtggagcaaaggactgg
gaaaacaataaggttcttatcaatcaaagcatgactgcctatccctgctcctgctccaat
agttccaaggactttcaggtagacagtggtttctgtaatctggatgtccctgtcaacggc
actgcaacatatgctgactggcctgttcatgagcagggatgtatggatggcgtagaggag
tggttgaaggacaaccttggtgtcattcttggggtctgcaccggtgttgctgttatagag
ctgctggggatgatactgtccatttcactctgcaagaacatacacagcgaagactacacc
aaagtgcccaagtcttga

DBGET integrated database retrieval system