KEGG   Columba livia (rock pigeon): 102085712
Entry
102085712         CDS       T02912                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv05132  Salmonella infection
clv05164  Influenza A
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102085712
   04115 p53 signaling pathway
    102085712
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102085712
  09172 Infectious disease: viral
   05164 Influenza A
    102085712
   05168 Herpes simplex virus 1 infection
    102085712
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 UPF0128
Other DBs
NCBI-GeneID: 102085712
NCBI-ProteinID: XP_005513534
UniProt: P00021 A0A2I0MQ77
LinkDB
Position
Unknown
AA seq 105 aa
MGDIEKGKKIFVQKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAEGFSYTDANKNKGITW
GEDTLMEYLENPKKYIPGTKMIFAGIKKKAERADLIAYLKQATAK
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggagatattgagaaggggaagaagatctttgtccagaaatgttcccagtgccataca
gttgaaaagggaggcaagcacaagactggacctaacctgcatggcctatttggacgcaag
acgggacaagctgagggcttctcttacacggatgctaataagaataaaggtatcacttgg
ggtgaggataccctgatggagtatttggaaaatccaaagaagtatatcccaggaacaaag
atgatttttgcgggtattaagaagaaggctgagagagcagacttaatagcatacctcaaa
caggccactgcaaagtaa

DBGET integrated database retrieval system