KEGG   Columba livia (rock pigeon): 102085908Help
Entry
102085908         CDS       T02912                                 

Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6 isoform X2
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    102085908
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     102085908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core
Motif
Other DBs
NCBI-GeneID: 102085908
NCBI-ProteinID: XP_005499704
LinkDB All DBs
Position
Unknown
AA seq 696 aa AA seqDB search
MADLTPTHISWQPSVNASTHHTDRYTSTELTVRRGQAFTITLYFNRPQQAGEHLAFVTEI
GPSPSESHRTRAVFNLSEVGASGWSATQGPSESGYTNFTISSPANAVIGRYNLILQVTSG
NKIISRFLGQFVLLFNPWCPGDDVYMANENERQEYVLNENGIIFVGNAKYIEARGWYYGQ
FQDHLLNVCLTMLDLSLYYRQDPAIDVSRRGDPKYVGRVISSMINGNDNDNGVLLGKWEG
SFHSHENPSRWDSSVVILQKWRQDNYKPVQYGQCWVFAGVMCTVLRCLGIPTRLVSNFNS
AHDVDRNLSIDKYYDSSGKSLNIGKDSTWDYHVWNESWFVRPDLGSSYNGWQVLDATPQE
QSKGLFQCGPASVVAIKEGDVNLDYDTLFVYTEVNADCNRWIVYSNGTKKRVYCDTEIIG
RFISTKAVGSNSRVDVTYNYKYPEGSPEERRVYKKALAKILGSNITAGHTESPAERSSET
LRNPGISGKFKLAEPPVFGKDVSLILILNNLSSDQKTVKVDMSASTVLYTRRAVTEILKA
TTSVDLGPKQGKHIRLNIPYSYYGKYLTTDKRIQVTALCEVMHMHGVKLLVEKTIILEDT
NIIIKIPRQAVVNRAVTLEISYANPLPEPVSRCVLLVTLMNQQVKINLAQLAPRERSKIY
FEFTPRRPGPLQLQVDFSCDKFSHVKGFATIAVAPA
NT seq 2091 nt NT seq  +upstreamnt  +downstreamnt
atggcagatctgacaccaacacatatcagctggcaaccatcggtaaatgcaagcacacac
catactgacaggtataccagcaccgagctgactgtgaggcgaggacaagctttcactatt
accctgtacttcaacagaccacagcaggctggagagcacctggcatttgtcactgaaata
ggaccatccccctcagaatcccatcgtacgagggctgtatttaacctctcggaggtgggg
gcaagtggctggagcgctacacaaggaccctccgagtccggctatacaaactttacaata
tccagcccagccaacgctgtcatcggacgatacaatctcatcctccaggtaacctcaggg
aacaagatcatctccagattcctagggcagtttgtgttactcttcaacccttggtgccca
ggtgatgatgtctacatggctaatgaaaatgagagacaagaatatgtgctaaatgaaaat
ggaataatcttcgtgggcaatgcaaagtacattgaagcaagaggatggtactatggacaa
tttcaagatcaccttctaaacgtctgtctcaccatgcttgatctgagcctgtactatcgt
caggacccagccattgatgtatcccgaagaggagatcctaaatatgtgggccgagtaatc
agttctatgatcaacggaaatgataacgataatggagttctcctgggaaagtgggaagga
agcttccattcacatgagaatccatccaggtgggacagcagcgtggtgatcctccagaaa
tggcgccaggacaactacaagcctgttcagtacggccagtgctgggtttttgcaggcgtg
atgtgtacagttctgaggtgcttggggattccaactcgtttggtttcaaattttaactct
gctcatgatgtggacagaaacctgagcattgataagtactatgacagctctggaaagagt
ctgaatatcggcaaggattccacatgggattatcacgtctggaatgaaagctggttcgtt
cgtccagacctgggaagctcatacaatggatggcaggttttagatgcaactccacaagaa
caaagcaaaggattatttcaatgtggccctgcatctgttgtagccatcaaagaaggcgat
gtaaacctggattatgacaccttatttgtgtacacagaggtgaatgccgattgcaacaga
tggattgtatacagtaatggaactaagaaaagagtttattgtgatactgaaataattggc
aggtttatcagcaccaaggctgtgggcagtaattcccgtgtggatgtcacctataattac
aaatatccagaaggttctcctgaggaaagacgagtttataaaaaggccttggccaagata
cttggatccaacatcacagcaggacacacagaatctccagctgaaagatcttcagagaca
cttagaaaccccgggatctctgggaagttcaagctggctgaacctccagtgtttggcaaa
gacgtttccctaatcttaatcctcaataatttgtcttctgaccagaagaccgtgaaggtg
gacatgagtgcgtcaaccgtcctctacacaaggagagcagtgacagagatcctgaaggca
accacttctgtggatctcggtcctaagcaagggaaacatatccggttaaatatcccttat
tcttattatggaaaatatctgactacggacaaaaggatccaagtcaccgctttgtgtgaa
gtcatgcacatgcatggggtgaagttgctggtggagaagacaatcattttagaggacaca
aacattatcattaagattcctcggcaggctgtggtgaacagagctgtcaccctagagatc
tcctacgccaaccccctccccgagcccgtgagccgctgtgtgctgctggtgaccctgatg
aaccaacaggtcaagataaatctggcacaactggcaccgagggagagatcaaaaatctat
tttgaattcacacctcgcaggcctgggcccttacagctgcaagtagacttctcttgtgac
aaattttcacatgttaagggatttgcaaccattgcagtagcacctgcataa

DBGET integrated database retrieval system