KEGG   Columba livia (rock pigeon): 102085982
Entry
102085982         CDS       T02912                                 

Gene name
ATR
Definition
(RefSeq) serine/threonine-protein kinase ATR
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv03460  Fanconi anemia pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
clv04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    102085982 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102085982 (ATR)
   04115 p53 signaling pathway
    102085982 (ATR)
   04218 Cellular senescence
    102085982 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102085982 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:clv03400]
    102085982 (ATR)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102085982 (ATR)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102085982 (ATR)
DNA repair and recombination proteins [BR:clv03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102085982 (ATR)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT UME FATC HEAT Mad3_BUB1_I TRIF-NTD
Other DBs
NCBI-GeneID: 102085982
NCBI-ProteinID: XP_021147808
LinkDB
Position
Unknown
AA seq 2788 aa
MAGPGELPEDPLSALHRDACRGRIPPGSPGSSSVPTLGKGYTLAECARPVVSCLCAAAEI
PARTACVPGGSPLEIGTKPPFTRSRLVTNRLNCRRAAGARSRPCDAAKVLGPAGRRHAVP
ALAARGPFQSEQGLEMASVIPALRELASASPEDYNTVVQKPRQILCQFIDRILTDVDVVA
LELVKKSDSQPSSVMLLDFIQYIVKSSPLMFVNVHGNQEETEGSCIEFSNWIITRLLRIA
ATPNCNTLHKNICDVICSLLFLFKMKSCSIFEVLTKDLLQLFQDLIFLHERDAQKHLWGD
ALLWPVTVKRFSSNTSDNVGYLRLAPLQLMGMPYLECLEVILMSVLTDIVADVFFVRQDT
VLWGIGCSLLEYGSPKVKALAVKFLVKLINLGGPPDQLASVFFTVFFGILQSALEMDTEE
SELFGEPLLLLVRALLPFEADSYKNIEPVYLNMLLEKLCALFEGDVFRCLQSEKLKAAFC
HILQYFLEFVPAGYESALQVRKVHISTICGIFVSVLGTQEEQEYLVSPLYTALKTQTEEI
LQELHRNQLDTSDTDGWSSSSDEVPPKRQRLSLATKHPKKSPTPVIFSPVNMKSKNTLWN
AISKKAASLIFVLEKEILTANILQTVEGIAVILRLAALCIVHCSPPTNSTSIDHKVTHPC
TSDTCKNTLSSSDAVVNIQFTWISCDFITRVVKVCRNLLEAATQIVNLEHVIDRIVRIFD
ALLYAQVKIPLSDQILDNLCGLLSLPWIYSHPDDSSFKPSAFGFDPLALSQKTAKSFSPR
AQSHCAFLLSLFPRKICLDWRKSVYHWALQSPHEVIRAACVKGFSLLLHPSSVQSSSMIP
RSLLNQIKDESELVKEACAAVIGKLSCCLAGTFSVRPSLADSAVKHVTCDILCSSLTVTS
AHEKTCSVQACVFKPFLILLENEVSSSVKLAFIENIPHLCKHLDFNTDESSVKILVGSLL
NLMEDPDKDVRVAFSDCIKNILESLDSEEGFIKELFVSRMKEAYTKAKISRNNELKDTLI
LTTGDIGRASKGDLVPFALLHLLHCLLSKSTSVAGAAYTEIRSLAAAKSIKLQAFFSQYK
KPICQFLVESLHSSQMAVSSALCQGNELQKQTAAHQREMALDMLSEVANVFDFPDLNRFL
SRTLQVLLPDLAAKASPAASTLIRIIAKQLNVNRREILINNFKYIFSHLVCSCSKDELER
ALHYLKNETEIELGSLLRQDYQGLHNELLLRIGEHYQQVFNGLSILASFASHDDPYQGPR
EITSPEQMADYLQPKLLGILAFFNMQLLSSSVGIEDKKMALNSLMSLMKLMGSKHISSVR
VKMMTTLRTALRYKDDFPELCCRAWDCFVRSLDHSYLGSLLSHVIVALLPLIHIQPKETT
AVFYFLIVENRDAVRDFLHEIYFLPDLPELKEIQVVLQEYRKESSKSTDLQTILKLSMRA
IQHENVDVRIHALTSLKETLYRNQEKLIKYVTDSETVEPVISQLVTVLLIGCQDANSQAR
LLCGECLGELGAIDPGRLDFSTSETQGKHFTFVAGVEDPNFAYGLLMELTRAFLAYADNV
RAQDSAAYAIQELLSIYDCRETNTDCPGSRLWRRFPEHVQEILEPHLNTRYKSYQKAVNW
SKMKKPIYLSKLGDNFAEWSATWAGYLITKVRHDLARKVFDCCSIMMKNDYKVTIYLLPH
ILVYVLLGCSQEDQQEVYVEIMAVLKHDDQSTRRLEDSASDLSQLSMQTVFSMLDHLTQW
ARHKFQMLIAEKNTSKSSKDRGDLKTSSEDHGEYQNVTRFLDLIPQDTLAVASFRSKAYT
RAVMHFESFITEKKQNIQEHLGFLQKLYAAMHEPDGVAGVSAIRKAEPSLKEQILEHESI
GLLRDATACYDRAIQLEPDQIIHYHGVVKSMLGLGQLSTVITQVNGVLANRSEWISELNT
YRVEAAWKLSRWDLLENYLASDAKSTTWSVRLGHLLLSAKKKNEAAFYETLKVVRAEQIV
PLSAASFERGSYQRGYEHIIRLHMLCELEHSIGPMFQQPAGDHGRDSLNWCARIEMTQNS
YRAKEPILALRRALLSLSKSQDYSELLGQCWLQSARVARKAGHHQTAYNALLNAGESALS
ELYVERAKWLWSKVKVHQALIVLQKGVDLCFPENKAPCNTKNQLIHGRAMLLVGRFMEET
ANFESNAVMKKYKDVTVFLPEWEDGHFYLAKYYDKLMPMVTDNKMEKQGDLIRYIVHHFG
RSLQYGNQFIYQSMPRMLSLWLDFGAKAYECDKASRSERVQMKNDLAKINKVITEHTNHL
APYQFLTAFSQLISRICHSHDEVFAVLMVIVAKVFLAYPQQAMWMMTAVSKSSYPMRVNR
CKEILNKAIHMKESLGKFIGDATRLTDKLLELCNKPVDGNSSTLSMNIHFKTLKRLVEEQ
TFSEILIPLQSVMIPTLPSVPGTHANHDPFPGCWAYIAGFDDTVEILASLQKPKKITLKG
SDGKSYIMMCKPKDDLRKDCRLMEFNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGI
IEWVNNTAGLRNILIKLYKEKGIYMTGKELRQHMLPKSAPLSEKLKMFKEVLLPRHPPLF
HEWFLRTFPDPTSWYNSRSAYCRSVAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFN
CLFNKGETFEVPEIVPFRLTHNMVNGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKT
FLHDPLVEWSKPVKGNTKAQVNETGEVVNEKAKTHVLDIEQRLQGVIKTRNRIKGLPLSI
EGHVHYLIQEASDDNLLCQMYMGWAPYM
NT seq 8367 nt   +upstreamnt  +downstreamnt
atggcgggcccaggggagcttcccgaggacccgctctctgccctccaccgtgacgcctgc
cgcggccggatcccgcccggcagtcccggcagctcctcagtgcccacgctgggaaagggc
tacaccctggcggagtgcgctcggcccgttgttagctgtctgtgcgctgcagcggagatc
cctgcccggacagcatgcgtccccggggggagccccttggaaatcggcactaagccgccg
ttcacgcgctcccgcctagtgacgaaccggttaaactgccgccgcgccgccggggcgcgc
agccgcccttgcgacgccgcgaaagttttgggtcctgccggacgccgtcacgcagttccc
gccttggcggcgcgcggcccgtttcaaagcgagcagggcctggagatggcctccgtaatc
cccgcgctgcgggagctggccagtgctagtccagaagattacaatacagttgtgcagaaa
ccaagacaaatactctgccagttcattgacagaattcttacagatgtagacgttgttgct
ttggaactggttaagaaatcagattcacagccaagttctgtaatgttgcttgattttatt
caatacatcgtgaaatcttccccacttatgtttgtaaatgtgcatggaaatcaggaggaa
actgaaggcagttgcattgaatttagtaactggatcataacaaggcttctccgaattgct
gcaactccaaactgcaacacgttgcacaagaacatttgtgatgttatttgctctttactt
tttctgtttaaaatgaagagttgctccatttttgaagtactaacaaaagacttgctacag
cttttccaagacttaatcttcctgcatgaaagagatgcacagaagcatctctggggagat
gcattgctctggccagtgactgtaaagagattttctagcaatacaagtgacaacgtggga
tatttaagattagcaccattacagctgatgggtatgccctatctggaatgtttggaagtt
attttaatgtctgttctgacagatattgtcgcagatgtgttttttgtaagacaagatact
gttctgtgggggataggctgctccctgttggagtatggcagtccaaaagttaaagctttg
gcagtgaagtttttagtaaaattaattaatttaggaggacctccggaccagctggccagt
gttttctttacagtcttttttggaattctccagtcagcacttgaaatggatactgaagaa
tcagaactctttggagaaccactcttactgttggtgagggcattgttgccttttgaagca
gattcttacaaaaatattgaacctgtctacttgaatatgctactagagaagctctgtgca
ttgtttgaaggtgatgtgtttagatgtcttcagtctgaaaagctgaaagctgctttttgc
catatactgcagtattttctggagtttgttccagctggctatgaatctgccttacaagta
agaaaagtccatatcagcaccatatgtggcatttttgtgagtgtgcttggaactcaggaa
gaacaagagtatctagtgagcccgctttatacagcattaaaaacacaaacagaagaaatt
cttcaggagcttcatcggaatcagctagatacttctgatactgatgggtggagcagcagc
agtgatgaagttccgccaaagagacaacgactaagcctagcaacaaagcatccaaagaaa
tcgcctacaccagtaatatttagccctgtaaacatgaaatcgaagaacactctgtggaat
gccatctcaaagaaggctgcctccttaatatttgtccttgagaaagaaattctgacagcg
aatattcttcagactgtagaagggattgctgtaattctgcgactagctgctttgtgcata
gttcattgttctcccccaacaaattctaccagcatagatcacaaagtaactcatccatgc
acctctgacacatgtaagaatactctgagctcctcagatgcagtggtgaacatacagttt
acatggatttcctgtgattttatcacaagagtagtgaaagtctgcagaaacctgttagag
gctgctacacagattgttaacttagagcatgtgattgacagaatcgtgagaatctttgat
gctttgctgtatgcacaagtgaaaattccactgagtgatcagattcttgataacttatgt
ggattactgtctctgccctggatttacagccatcctgatgattcttcttttaagccatct
gcttttgggtttgatcctctagctttgagtcaaaaaactgcaaagagtttctcaccccga
gctcaatcacactgtgcgttccttctgtctctcttcccaagaaagatttgtctggattgg
agaaaatccgtttatcattgggcactacaaagtccccatgaagtaattcgagctgcttgt
gttaaaggattctctctcctgcttcatccatcaagtgtgcagtcctccagtatgattccc
agatctcttttaaatcaaatcaaagatgagtctgagctagtgaaggaggcttgtgctgct
gtaattgggaaattatcttgctgtcttgctggtacattcagtgtgcgaccttccttagca
gactctgctgttaagcatgttacctgtgatattttatgtagcagccttactgtgacttct
gctcatgaaaaaacttgttctgtgcaagcctgtgttttcaagccatttcttattctcctt
gagaatgaagtatccagttcagtaaagctagcatttatagaaaatatacctcatctttgc
aaacatctggattttaacactgatgagtccagtgtgaagattcttgttgggtctttatta
aatctaatggaagatccagacaaagacgtaagagtggctttcagtgactgcataaagaac
atactagaatccttagactccgaagaaggattcataaaagagctgtttgtttcaagaatg
aaagaagcctatacaaaggccaaaatatcaagaaataacgagcttaaagataccttgatt
ctcacaacaggagatattggaagggcatcaaaaggggatttagtaccatttgccctcttg
catttgttacactgtttgttgtccaagtcaacttctgtggctggagcagcatacacagaa
attcgatccttggcagctgctaagtccataaagctgcaagcatttttcagtcagtacaag
aagcctatctgtcagtttctagtggaatccctgcactccagccagatggcagtatcaagt
gctctgtgccagggtaatgagctacagaaacaaacagctgcccatcagagagaaatggct
ctggacatgttatctgaggtcgccaatgtatttgattttccagatctaaatcgctttctc
tcacggaccctacaagttttgcttcctgaccttgcagccaaggctagtcctgcagcctcc
acacttattcgaatcatagcaaaacagctgaatgtaaaccgaagagagattttaatcaat
aacttcaaatacatcttctcccatttggtctgttcgtgctccaaggatgagcttgagcgg
gcgcttcattacctcaagaatgaaactgagatagagctgggcagcttgctgagacaggac
taccaaggactgcataatgaattattgctgcgtataggagaacactatcaacaggtcttc
aatggtttgtcaatattggcttcatttgcatctcatgatgatccttatcagggacctaga
gaaataacatcacctgaacaaatggctgattatctgcaacctaaattgcttggtatcttg
gctttttttaacatgcagttactgagttctagtgtgggcattgaggataaaaaaatggct
ttaaacagtcttatgtctttaatgaagctcatgggttccaaacacatcagttcagtaaga
gtgaagatgatgactacactgagaacagctctaagatacaaggatgactttccagaactg
tgttgcagagcctgggattgttttgttcgaagtctggatcactcataccttggctccttg
cttagtcatgtgatagtggcattattgccacttatacatatccaaccaaaggaaactaca
gcagtattttactttcttatagttgagaacagggacgcagtacgagactttttacatgaa
atatattttctgcctgaccttccagaactaaaagaaattcaagtcgtccttcaggaatac
agaaaagaatcctccaaaagcactgacttgcagacaatactgaagctgtctatgagagct
attcagcatgagaatgtggatgttcgtattcatgcacttaccagcctgaaagaaacgtta
tatagaaatcaggaaaaattgatcaagtatgtaacagacagtgaaactgtggagccagtc
atctcccagttggtaactgtgcttctcatcggctgccaggatgcaaattctcaagcccga
ttgctttgtggagagtgtttaggtgaactgggagccatagatcccggcaggctggatttt
tcaacaagtgaaactcaaggaaagcattttacatttgtggctggtgtggaggatccaaat
tttgcctacgggttattaatggaactgaccagagcattccttgcttatgctgataatgtt
cgtgctcaggattctgcagcatatgcaattcaggagctgttgtctatctatgactgtaga
gagacaaacactgactgcccaggctccaggctttggaggaggtttcctgagcacgtgcag
gagatcttggaacctcacttgaatacacggtacaagagttatcaaaaggctgtaaattgg
tctaagatgaagaagccaatttacttaagcaaattaggtgataattttgcagagtggtca
gcaacttgggcaggttatcttataacaaaggtacgacatgatcttgccagaaaagttttt
gattgctgcagtattatgatgaagaatgactataaagtgacaatttatctgcttccacac
atccttgtctatgttctgttgggatgcagtcaagaggatcaacaagaggtttacgtggag
attatggctgttctgaaacatgatgaccagtctactaggagacttgaagacagcgcatct
gatctcagtcagctgagcatgcagacagtgttctccatgcttgatcatctcactcagtgg
gctagacataagtttcagatgcttattgccgagaaaaacactagcaagtctagcaaagac
agaggtgatctaaaaacatcaagtgaggaccatggagaatatcaaaatgtgacacgtttt
ctagacctcatacctcaggatacactggctgtggcttcctttcgctccaaggcttacaca
agggctgtaatgcactttgaatcattcatcacagagaagaaacaaaatattcaggagcat
cttggatttcttcagaaattgtatgctgctatgcatgagccagatggagtagctggggtg
agtgccattcggaaagcagaaccatctctcaaagaacaaattcttgaacatgaaagtatt
ggcttgttaagagatgcaacagcctgttatgatagggctatccaactggaacctgaccag
attattcattatcatggtgtagtgaagtccatgttaggccttggtcagttatctactgta
attactcaggtcaatggagtgcttgcgaacaggtctgaatggatttctgagttgaacact
tacagagtggaagcagcctggaaactgtcacgatgggatttactggaaaattatttggct
tccgatgcgaagtccactacttggagtgtcagactaggacatttattattatcagccaag
aagaaaaatgaagcagctttttatgaaacactcaaagttgttcgagcagaacagattgta
cccctttcagcagcgagctttgaaagaggatcctatcagcgaggatatgaacacattatc
aggttgcatatgctgtgtgagttggaacatagtattgggccaatgtttcagcaaccagct
ggtgatcatggaagagattccctgaattggtgcgctcgtattgaaatgacccagaactct
tatagagccaaagagcccattttagcactgaggagggctttgcttagtctcagtaaaagc
caggattacagtgagctgcttggtcagtgttggctccagagtgccagagttgccagaaaa
gctggtcatcaccagactgcctataatgctcttctgaatgccggggaatctgcgctctca
gaactttatgtagaaagagcaaagtggctctggtccaaggtaaaggttcatcaagcactc
attgttctccagaagggggttgatttatgtttccctgaaaataaagcaccgtgcaatacc
aaaaatcagctcatccatggccgggcaatgctgctagtgggcaggtttatggaagaaact
gctaactttgaaagcaatgcagttatgaaaaagtataaggatgttacagttttcttgcca
gaatgggaagatggacatttttatcttgctaaatactacgacaaactaatgccaatggta
actgacaacaagatggaaaaacaaggagatctgataagatacatcgttcaccattttggg
aggtctctccagtatggaaaccaattcatctatcagtcaatgccaagaatgctgtctttg
tggctggacttcggggcaaaagcatatgaatgtgataaagctagtcgttcagaacgtgtt
caaatgaaaaatgacttagctaaaataaataaggtgattacagagcacacaaatcacctg
gcaccttaccagtttctgacagctttttctcagttaatctcccgaatctgccattctcat
gatgaagtctttgcagttctgatggtgattgttgctaaagtgtttttagcctatccacag
caagcaatgtggatgatgactgctgtgtccaagtcctcttaccctatgcgtgttaataga
tgtaaggaaattctgaacaaagctattcacatgaaggaatctctaggaaaatttattgga
gatgcaacacgccttacagataagctcttggaactatgcaacaaaccggttgatggaaac
agctcaacattaagcatgaatattcatttcaaaacacttaagagattagtagaagagcaa
acttttagtgaaattctcattcccttgcaatctgtaatgataccaactcttccttcagtt
cctggaacacacgccaaccacgaccctttccctggatgctgggcctacattgcaggcttt
gacgatacggtggaaattcttgcctcacttcaaaagccaaaaaagatcaccttgaaaggc
tcagatgggaaatcttacattatgatgtgtaagccaaaagatgatctaaggaaagactgt
cggctcatggaattcaactcccttattaataagtgcttaagaaaagatgcagagtcacgt
aggcgagaactccatattcgaacctatgcagttattccattaaatgacgaatgtggcata
attgaatgggtgaacaatactgctggtttaagaaatatcctgataaaactttacaaggag
aaaggtatctatatgactggaaaagaattgcgccagcatatgcttccaaagtcagcacct
ttgtctgaaaagctgaaaatgttcaaagaagtccttctgcctcgtcaccctcctctcttt
catgaatggttccttagaacgtttcctgatcctacttcctggtacaacagtaggtcagcc
tattgtcgctctgtggcagttatgtccatggttggttacatactcggtctgggagaccgt
catggtgagaacatcctgtttgattctctgactggtgaatgtgtgcatgtggatttcaac
tgccttttcaataagggagaaacttttgaagttccggaaattgttccttttcgtctcact
cacaacatggttaatgggatgggtccaatgggaacagaaggtctcttccgaagagcttgt
gaagtcacaatgaggctcatgcgagaccaaagggagcccctaatgagtgtcttaaagact
tttctccatgatcctctcgtggaatggagtaagcctgttaaaggaaatacaaaagcacag
gtgaacgaaactggagaagttgtcaatgaaaaggccaaaacccacgtccttgatatagaa
caaaggctgcaaggtgtcattaagactagaaacagaataaaaggcctacccttatctatt
gaagggcatgttcattacctcattcaagaagcaagtgacgacaacctgctctgccagatg
tatatgggctgggctccatatatgtga

DBGET integrated database retrieval system