KEGG   Columba livia (rock pigeon): 102086207
Entry
102086207         CDS       T02912                                 

Gene name
ATM
Definition
(RefSeq) serine-protein kinase ATM
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv03440  Homologous recombination
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102086207 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102086207 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102086207 (ATM)
   04210 Apoptosis
    102086207 (ATM)
   04115 p53 signaling pathway
    102086207 (ATM)
   04218 Cellular senescence
    102086207 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102086207 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:clv03032]
    102086207 (ATM)
   03400 DNA repair and recombination proteins [BR:clv03400]
    102086207 (ATM)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102086207 (ATM)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102086207 (ATM)
DNA replication proteins [BR:clv03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     102086207 (ATM)
DNA repair and recombination proteins [BR:clv03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102086207 (ATM)
SSDB
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC LRAT
Other DBs
NCBI-GeneID: 102086207
NCBI-ProteinID: XP_021141965
LinkDB
Position
Unknown
AA seq 3068 aa
MSLALNELLVCCRRLENERAVERRKEIDNFKRLLRDPETVLQLDRNSDSKQGKQLNWDAV
FSLLQKYFQKEMKNLLLTKPNASASTQTTRQKKMQEVGSLVKYFIRCANKRGPRLKCQEL
LIYVMEIIRDPTSCAAYGSDCSNMLLKDILSVRKYWCEISQQQWSELLVLYGQLYLRPSG
KINRVLVAKIIHTLTRGYCFQTDGLSSDMFIFFSKAMQCARKEKNTAGLEHIVGAMNIFF
NKFAVDCRIRICKVGEEILPAVLYMWTQYRPKDSLKESIIELLRLQVHIHHPKGAKTQGK
GVYDSPKWQSILQNLYDLLVNEINLISSRGKYSSVSRNIAIKENLIELMADICHQVFTED
TRVLEITQSYAVTQRESSGETAPSKRRRIELGWEVIRGNLQRSQEDFDVIPWLQITAQLI
SKYPVSLPNSELPPLLNVLHQLLPHQRRGERTPYVLKCLTEVALCQNQKNGLKSTHRLEL
QRTWAKIWSLTIRSVSFQQIEVESFGLLEAMIQGNLVVTDKELWKIFSGPACKPSSSAIC
CLSYVMSTYSVPETLDVGMEQNSGERNLGSVLKEAIMKWVLSCYLEEEMEECAELPPVLC
SDFPHLMLQKILVSLTMKNCRAAMIFFQNDAKCVQHLQGKEDNHFSDIEELYLQTTFDEM
DVFTKFAVNVTDKNVTRSRLAINQNLRETLEHCLLAMSEKLLSSYAPKSKLVAAEHLVRC
VSLLIGVLGCYCYTGIFKEEDACKSELFQKAKSLLHYAGESISQSKNKLNEDAQVNSLRT
LISQCTKCLCNCTKNSANKMQSNIFLRLLTSKFMDDLVDICKNLMVFTGKPSELGEVDLT
GNDPEESIMEVDNQLSDDLFDDHTVTDINDTNEYGEMQNVTGPLSPLAEEQLTKQDLLLL
EILRCLCICVTTVQIQPVSFRASDIRRKLLTLTDGSIFDTTKPLHLHMYLVLLKELPSEE
HILPEDEVLMLLRPLSDVCSLYRRDQEVCKVILSNLLPVAVGLAQTHAHAEETGDAQGQF
LTVVRAFWYLAQEGKCTASVRVALLNCMKAVLEADPHCKWVMLNVGNEDLPVSDAFPHFL
ADSHHQVRILAAKSITSLFQDVKQRDSSGMSKPLPSKLQQKAFENAYLRVQEGMRNLVRG
DASPEDLLDRQCNGKAVLLMLVAMILCCSPVCEKQALFAVCQSVKENELEPHLVKKVLKK
ISDIFGYKSIEDFMTSHLDYLVMEWLKINDSGYSLSAFPYVLLNYTSLEEFYRSCYKVLV
PHLVIRSQFEDVKSLADQIEKDWRQVLADCFPRILVYILPYFACESLGKSEVAEQRDTAS
KVYDMLKDENCLGKQQIDNLSHNNLPEIVVELLMTLHEPHDTTVGEGAPLSKYVRELDPA
PNPPHFSSYVIQTTLDYINKCHKSKLTSLVAVLSKSPDSFQKILLALCKHASDTNNIYKK
HRVLVIYHLFVSLLLKEIKDGLGGAWAFVLRDVIYTLIHHINSRPVIIRDISMCSFSVCC
DLLHDVCHTAVTCCNDALESHLHVIVGTLIPLAMDQPEIQEQVLGLLKYLVIDNKDNENL
YQAIKCLDPFPEYPAFKDLRATQQKIKYSKGPYSLLEEIDHFLSVGVCDSLPLTRLEGLY
DLRKQLEQYKDQMKELLKNFQEKPEDSVVVKLVVSLLQLSKAAVNHPGGTAVLEAVGSCL
GEIGPMDFSTIALQHAENALDSKAADLLQDRKLQWVFIMLTQINIALTDNCIDIRAAAVS
CLKNILATKSGSEFWEVYKTKTDPMLIYLQPFRMSRKKFLVVPANDVEAPLETLDDTNLW
IPLGESHETWIKRLTSSVLDSGGVQSEVLQLMKPLCEVKTDLCQTLLPYLIHDILLHDSD
ESWRNLLSVHIQKFFTACCKFASSSRSSTPPNSDSEQETHNFRSLDKVSRRAMLAVVDYL
RRQKRSVSGTVFDDSFWLDLNYLEVAIAAQSCAAHFTALLYAEIYADKINRDKQQKRSSF
KAAKSLTFEEESQRTTITILNEKSKEETGISLQDLLMDIYRSIGEPDSLYGCGGGRMLQP
LARIRTYEHEAVWEKALVTYDLEASLSPSMRQAGIIEVTFFYKKKQILSMYLKGLEHENT
EWCAELQEMRYQAAWRNMQWGHLSSVKDETGRPGYHESLYDALQSLRDKEFSTFYDSLKD
ARVNEVEELCKGSLESVYSLYPTLCRLQLIGELENIGQLFSRSVTPQQLNDIYLKWQRQS
QLLKDSDFCFQEPVMALRTVILEILLEKENENTKRECIKDILTKHLVELSRLARTAKNTQ
IPERAMFQIKQYNPTAYGVSEWQLEEAQVFWAKKEESLALNILKRMIKTLDADLFQVEND
PHLKLMYTECLRLCGTWLAETCLENPTVIMQKYLEKAVEIATSRSGDGSDELKKGKMKAF
LSLARFSDNQYQRIENYMKSSEFENKQALLKKAKEEIGLIRERRVETNRYTVKVQRELEL
DECAIQALTEDRKRFLCKAVENYISCLLSGEEHNMWIFRLCSLWLENSGVDRVNEMMKEN
AEKIPSYKFLPLMYQLAARMGTKMMGGFGFHEVLNKLMSRISLDHPHHALFIILALANAN
KDELLTKPDAKRRNNLIKNAPKEISQLDVDRTEAARNIISIVRKKRAHMVRDVEALCDAY
ITLANLDATPWKTQRKGIRIPADQPITKLKNLKDVVVPTMEIKVDPTGRYENLVTIMSFK
PEFRLAGGLHLPKIIDCVGSDGKERRQLVKGLDDLRQDAVMQQVFQMCNTLLQQNTETRK
RKLTIRRYKVVPLSQGSGVLEWCSGTTPIGEFLVNVEEGAHKRYRPKDYSSYQCQKIMMD
AQRKHSEEKYNIFMEVCENFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILG
LGDRHVQNILIDEQTAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVF
RRCCEKTMAVMRNSQEALLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDEADMSSTLSTD
PQECKRKVSDDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLCRL
FYGWKPWV
NT seq 9207 nt   +upstreamnt  +downstreamnt
atgagtcttgcattaaatgagctgcttgtttgttgtcgtcgccttgaaaatgagagagct
gtggagcgaaggaaggaaattgacaatttcaagcgacttctccgtgatcctgaaacagtt
ctccagctggaccggaattcggattctaaacaaggaaagcagctcaactgggatgctgta
tttagcctcttgcagaaatacttccagaaagagatgaaaaacctactactgacaaaacca
aatgcatctgcttcaacccaaactaccagacaaaaaaagatgcaagaagttggaagtttg
gtcaaatatttcatcagatgtgctaacaaaagaggacccagactgaaatgtcaggaactt
ctgatttatgtcatggaaattataagagatccaacaagttgtgctgcttatggatctgac
tgtagtaatatgctcctaaaagatatcctctcagtaaggaaatattggtgtgaaatatcc
cagcagcagtggtcagagttgctggtactgtatggtcaattatacctcagaccttctgga
aagattaatagagtcttggtggccaagataattcacacacttacgagggggtactgcttc
caaactgatggattgagttctgatatgttcatcttcttttcaaaagcaatgcagtgtgcg
aggaaggagaagaatactgctggcctggaacatattgttggagcaatgaatatcttcttc
aataagtttgctgttgattgtcgcatacggatttgtaaagtaggggaagaaattttgcct
gcagtgctttatatgtggactcagtatagaccaaaggattccctgaaggaatcaataatt
gagttacttcgtctccaagttcatattcatcatccaaagggtgcaaaaactcagggaaaa
ggtgtgtatgactcaccaaaatggcaaagtatcttacaaaacctatatgatctgctggtg
aacgaaataaatctcatcagtagtagaggaaagtattcttcagtctcacgtaatattgct
ataaaggaaaatttgattgagttaatggctgatatttgtcatcaggtttttacagaggat
accagagttctggaaatcacccagtcgtatgcggttacacaaagagagtccagtggtgaa
acagcaccaagcaaacgcaggaggattgaactgggctgggaggtaattcgaggcaacctg
caaagatcacaggaggattttgatgtcataccttggttacagattacagctcaattaata
tcgaagtatcccgtgagccttcctaacagtgagctacctcccttactcaatgtacttcac
cagttactgcctcatcagcgccgaggagaaagaaccccatatgtgctgaagtgtcttaca
gaggtagctttgtgtcaaaaccagaaaaatggtttgaaaagcacccacaggttggagctc
cagagaacctgggcaaagatttggtctcttaccattcgtagcgtaagtttccagcagatt
gaagtggaaagctttgggctacttgaagctatgattcaaggaaaccttgttgtgacagat
aaagaactctggaagatattttcaggacctgcatgcaagccttcaagttctgctatatgt
tgtttgtcatatgtgatgtctacctactcagtgccagaaactttggatgtagggatggag
cagaatagtggtgaaagaaatctaggttctgtgttaaaggaggcgataatgaaatgggta
ctgtcctgctatttggaggaagaaatggaagaatgtgcagagttgcctcccgtgctctgc
agtgattttcctcatcttatgttacaaaaaatacttgtgagccttacaatgaagaactgt
agagctgccatgatttttttccaaaatgatgctaaatgtgtgcaacacttgcaagggaaa
gaagacaaccatttttctgatattgaagagctgtatctgcagactacatttgatgaaatg
gacgttttcactaaatttgcagtaaatgttacagataaaaatgtgactcgttcaagactt
gccatcaaccaaaatcttagggaaactttggagcactgtcttttagcgatgtcagaaaag
cttttaagcagctatgctcccaagtctaagcttgttgctgcagaacatcttgtccgatgt
gtcagtctcttgattggtgttcttggttgctattgctacactggcatattcaaagaagag
gacgcctgtaagtcagagttgttccagaaagctaagtctcttcttcattatgctggagaa
agcatttctcagtctaaaaacaaactaaatgaagatgcccaggtcaactcattaaggact
ttgataagtcaatgtacaaaatgtttatgcaattgtaccaagaacagtgctaataagatg
cagtctaatatattcctgcgtttgttgacatcaaaatttatggatgatctcgtagatatt
tgcaaaaatctgatggtgtttactggtaaaccaagtgaactgggagaagtggatctaacg
gggaatgatcctgaggagagtataatggaagtagataaccagctatctgatgatctgttt
gatgatcatacagtgactgacatcaatgatacaaatgaatatggtgagatgcaaaatgta
acaggtcctttgagcccattagctgaagaacagttgacaaagcaggatttacttctcctt
gaaattctgaggtgcttgtgtatttgtgtaactacagtccaaattcagcccgtgagcttc
cgagcctctgatatacgcaggaaactgttgacacttactgatggcagcatctttgatact
actaagcccttgcatctgcacatgtacttggtccttttgaaggagctccctagtgaagaa
cacatcttgcctgaagacgaagttcttatgcttcttaggcctctttcagatgtgtgttct
ttgtaccgtcgagatcaagaagtttgtaaagtaattctaagtaatttgctccctgtagca
gtagggttggcccagacccacgcacatgctgaagagacaggggatgcccaaggacaattt
ttgacagtggttagagccttttggtatttagctcaagaagggaaatgcacagcatcagtg
agagtggcgcttttaaactgcatgaaagccgtgcttgaggctgatcctcattgcaagtgg
gtgatgcttaatgtgggaaatgaagatctgcctgtgagtgatgctttcccacattttctc
gcagatagtcaccatcaagttcgcattcttgctgcaaagtcgattaccagtttatttcaa
gatgtgaaacagagagattcttccggaatgtcaaaaccccttccctcgaagctccagcaa
aaggcttttgagaacgcctatctcagagttcaggaaggaatgagaaatctggtcaggggt
gatgcaagtcctgaagatcttttggacagacagtgtaatggaaaagcggttttgctgatg
ctcgtagccatgattctgtgctgcagtccagtctgtgaaaagcaagctttgtttgctgtg
tgccagtctgtgaaagagaatgaattagaacctcaccttgtgaaaaaggttttgaaaaaa
atatccgacatttttggctataaaagtatagaagacttcatgacatcacatttagactat
ttggtgatggagtggctgaaaataaatgacagtggatatagcctgtctgcttttccttat
gttcttctgaactatactagccttgaggaattctataggtcttgttacaaagttttggtt
ccacacctggtgattagaagtcaatttgaagatgtaaaatcacttgccgaccaaattgaa
aaagactggaggcaggttctagcagactgttttccaaggatacttgtgtatatcctccca
tattttgcctgtgaaagccttgggaagagtgaagtagcagagcagagagatacagcttct
aaagtctacgacatgcttaaggatgaaaactgcttaggaaaacagcaaattgacaattta
tctcataataacttaccagagattgtggttgaactgttgatgaccttacatgaaccacac
gataccacggtaggcgaaggagctcctctaagtaaatacgtaagggaactggatcctgct
cctaatccacctcatttttcatcttatgtgattcagacaaccttggattatattaacaaa
tgtcataaaagcaaattaacaagtcttgtagcagttctttcgaagagcccggattcattc
cagaaaatccttctagccctttgtaagcacgcatcagatacaaacaatatttacaagaaa
catagagttcttgtgatttatcacttgtttgttagtctgttacttaaagagataaaagat
ggtttaggaggagcatgggcttttgtcctccgagatgtgatttacaccctgattcatcac
atcaatagcagacctgttattatcagagacatatccatgtgcagcttttcagtctgttgt
gatctccttcatgatgtttgccacacagcggttacgtgttgcaatgatgctctagagagc
caccttcatgttattgtgggaaccctgatacctcttgccatggaccaaccagagattcag
gaacaggtcctaggcttgttgaagtacctggtgatagataataaggataatgaaaatctg
taccaagcaatcaaatgcttagatccttttcctgaatatcctgcttttaaagatttgcga
gcaactcaacagaaaataaaatacagtaaaggaccgtattctcttttggaggaaattgat
cactttctctccgttggtgtttgtgattcactacccttaacgcgacttgaaggactgtat
gatttacgcaaacagttagaacaatataaagatcagatgaaggagctcctgaaaaatttc
caggaaaagccggaagattccgtagtagtgaagctggtggtgagtttgctgcagctgtcc
aaggcggccgttaaccatcccggtgggacagcggtgctcgaggcagttggaagttgcttg
ggagaaatcggtcccatggatttctccaccatagctcttcagcatgctgagaatgcgctg
gattctaaagcagcagacttgcttcaagacagaaaacttcagtgggtcttcataatgtta
acacaaataaatattgctctaacagataattgcattgatattagggctgctgctgtttcc
tgtttgaaaaacatactagctaccaaatctggcagtgaattttgggaagtttataaaact
aaaactgatcccatgttaatctatctccagcctttcaggatgtcaaggaaaaagttttta
gtagtacctgctaatgatgtggaggctcctttagaaactttggatgacacaaacctgtgg
attcctctgggggaaagtcatgagacctggatcaagcgcctgactagttcagtattggac
agtggaggtgtgcaaagtgaagttctccagttaatgaagccactatgtgaggtgaaaact
gacttgtgtcaaactttgcttccatacctgattcatgacatccttcttcatgactcagat
gaatcttggagaaatcttttgtcagttcatattcagaagttttttacagcctgttgcaaa
tttgcctcatctagtagatcatctacacctccaaattctgattcagagcaagaaacacat
aattttagaagtttggataaagtatctcgacgagccatgcttgctgttgttgattactta
agaagacaaaagagatctgtttcaggtacagtttttgatgacagcttctggctggatctg
aattacctggaggttgcgatagcagcacagtcttgtgctgctcacttcacggccttgctc
tatgcagaaatctacgcagacaagataaatagagacaagcagcaaaaaaggtcatctttc
aaagcagctaagagtttgacatttgaagaagaaagtcaaagaacaactattactattttg
aatgaaaaaagtaaagaagaaactggcataagtctacaggaccttctcatggacatatac
agaagcattggagaacctgacagtctctatggctgtggtggaggaagaatgttacagcca
ttagcgcggataagaacatatgagcatgaagcagtatgggagaaagcccttgtaacatat
gatcttgaggcaagcctctctccgtctatgcgccaggcaggaataatagaggtaacgttt
ttttataagaagaagcaaattctttccatgtatttgaaaggactggaacatgaaaacacg
gaatggtgtgcggaactacaagaaatgcgctaccaggcagcgtggaggaatatgcagtgg
ggccacctctcttctgtcaaagatgagacaggaagaccagggtaccatgaatcattgtat
gatgctcttcagtctttacgagataaggaattctctactttttatgacagtctgaaagat
gccagagtgaatgaagtagaagagctctgcaaaggcagtcttgagtctgtttattcatta
tatccaactctttgcagactacagctaattggagagttggaaaatataggtcagctgttc
tccagatctgttactcctcaacagctgaatgatatttatttgaaatggcagagacagtcc
cagcttctcaaggacagtgacttctgtttccaggaacctgtaatggccttgcgcactgta
attttggagatcttgcttgaaaaggagaatgaaaacaccaaaagagagtgtattaaagac
atcctgaccaaacatctggtggagctctctagacttgcaagaactgctaaaaatacacag
attccagaaagagctatgtttcagattaaacaatacaatccaacagcatatggagtttct
gagtggcaactagaagaagctcaggttttctgggctaaaaaggaagagagtcttgcactg
aatattcttaaaagaatgataaaaacattagatgcagatttgtttcaggtcgagaatgat
cctcatctgaaattgatgtatacggagtgtctgaggctatgtggaacctggttagcagaa
acatgtttggaaaaccctacagtcatcatgcagaaatacttagaaaaggctgtggaaatt
gccaccagccgcagtggagacggcagtgacgagctgaagaaaggaaagatgaaggctttc
ctgtctttggctcgtttctcggataatcagtaccagcgaattgaaaattacatgaaatcc
tcggagtttgaaaataagcaagcgttactgaagaaggccaaggaggagatcggcctcata
agggagcgcagagttgagacaaatagatacacagtgaaggtccagcgagaacttgaactg
gatgaatgtgccatccaagccctcactgaggatcgtaaacgtttcttgtgtaaagctgtg
gagaactacatcagctgtttactgagtggagaagaacataatatgtggatcttccgactc
tgttcgctgtggcttgaaaattctggagttgacagagtcaatgaaatgatgaaggaaaat
gcagagaagatcccttcatacaagtttttgcctctgatgtaccagctggctgctcggatg
ggaaccaagatgatgggtggtttcggatttcatgaagttctgaataaactaatgtctaga
atttcactggatcatccgcatcatgctttgtttataatattagctttggcaaatgctaac
aaagatgaactcctcacaaaaccagatgcaaaaagaagaaataatttaattaaaaatgcc
ccgaaagaaatctcccagcttgatgtggacagaacggaggctgctcgcaatataatcagt
atcgtaagaaaaaagagagctcatatggttcgagacgttgaagcactttgtgatgcttac
atcactttagcgaatctggatgctaccccgtggaaaactcaaagaaaaggaataaggatt
ccagccgaccagccaattactaaactgaagaacctgaaggatgttgttgttcctaccatg
gaaattaaggtggatccgacaggacgatatgagaatttggtgacaattatgtcttttaag
ccagaatttcggttagcaggaggcctgcatctgcctaaaataatcgattgtgtaggatca
gatggtaaagaaaggaggcagctggttaaggggcttgatgacctgagacaagatgctgtt
atgcagcaggttttccagatgtgcaatacattgctccagcaaaacaccgaaacacgaaag
agaaaattaacaatccgaagatacaaggtggttcccctctctcagggaagtggggttctg
gagtggtgctcaggaacaacccccatcggggagtttctggtgaacgtggaagagggagct
cacaagagatacaggccaaaagattactccagttatcagtgtcagaaaataatgatggat
gcacaaaggaaacattctgaagagaaatacaacatcttcatggaagtttgtgagaacttt
cagcctgtgtttcgttacttctgcatggaaaaattcctggatccagctgtgtggtttgaa
aaacggttggcgtacactcgcagtgtggctacttcttctatagttggctacattcttgga
cttggagacagacatgtgcagaatatcttgatagatgaacaaacggcagaactagtgcat
atagatctgggggttgcttttgagcaaggtaaaatccttcccacaccagagacggttcca
tttagattaaccagggacattgtggatggaatgggtattactggcgtggaaggagtcttt
agaagatgctgtgagaaaacaatggctgttatgagaaattctcaagaagctttgctgact
atagtagaggtgctgctctatgatcctcttttcgactggacgatgaacccactgaaagcc
ttgtatttgcagcagagaccggaggatgaggctgacatgagctctacgctcagtactgat
ccacaagaatgtaaaagaaaagtcagtgatgaccagagttttaacaaagtggctgagcgt
gttctgatgagactccaggagaagctgaaaggtgttgaggagggaacagtgctcagtgtg
gggggacaggtgaacctcctcattcagcaggccatggacccgaaaaacctgtgccgactc
ttttatggatggaaaccctgggtgtga

DBGET integrated database retrieval system