KEGG   Columba livia (rock pigeon): 102086245
Entry
102086245         CDS       T02912                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
clv04218  Cellular senescence
clv04310  Wnt signaling pathway
clv04340  Hedgehog signaling pathway
clv04371  Apelin signaling pathway
clv04510  Focal adhesion
clv04530  Tight junction
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102086245 (CCND1)
   04340 Hedgehog signaling pathway
    102086245 (CCND1)
   04371 Apelin signaling pathway
    102086245 (CCND1)
   04068 FoxO signaling pathway
    102086245 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102086245 (CCND1)
   04115 p53 signaling pathway
    102086245 (CCND1)
   04218 Cellular senescence
    102086245 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102086245 (CCND1)
   04530 Tight junction
    102086245 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102086245
NCBI-ProteinID: XP_005511114
UniProt: A0A2I0MI34
LinkDB
Position
Unknown
AA seq 292 aa
MEHQLLCCEVETIRRAYLDANLLNDRVLQTMLKAEETCSPSVSYFKCVQKEILPYMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSFEPLKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLTKMPLAEDTKQIIRK
HAQTFVALCATDIKFISNPPSMIAAGSVVAAVQGLHLGNTNTFLSYQCLTHFLSQVIKCD
PDCLRACQEQIESLLESSLRQAQQHNVSSETKTVEDEADLSCTPTDVRDVNI
NT seq 879 nt   +upstreamnt  +downstreamnt
atggaacatcagctgctgtgctgcgaggtggagaccatccgacgagcctacctggatgcc
aacctcctcaatgacagggtgctgcagaccatgctgaaggcggaggagacctgctcgccc
tccgtctcctacttcaagtgcgtgcagaaagaaatcttgccatatatgaggaaaatagtt
gccacttggatgctggaggtttgcgaggagcagaagtgcgaagaggaagttttccccttg
gctatgaattatttggacagatttttgtcgttcgaacccctcaagaaaagccgattgcaa
ctgctgggagctacctgcatgtttgtggcttcaaaaatgaaggaaactattcctctgacc
gcagaaaaactgtgcatttatacagataactccattagacccgacgaattactgcaaatg
gagctgcttctggtgaataagctgaaatggaatctggctgcaatgaccccccacgatttc
attgaacatttccttactaaaatgcctctggcagaggacaccaagcagatcatccgtaaa
catgctcagacttttgtggctctgtgcgctacagatattaaatttatttcaaacccaccc
tccatgatcgcggctggcagtgtggtagcagctgtgcaaggcttgcatctggggaacact
aacactttcctctcctatcaatgcctcacacatttcctatcacaagttatcaaatgtgac
ccggattgtttacgagcctgccaagaacagattgagtccctcctcgaatccagtctacgt
caggcacagcagcacaacgtatcttcagaaacaaagactgtagaggatgaagcagacctt
tcctgcacacctaccgatgtgcgagatgtgaacatttaa

DBGET integrated database retrieval system