KEGG   Columba livia (rock pigeon): 102087151
Entry
102087151         CDS       T02912                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X2
  KO
K10140  DNA damage-binding protein 2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv03420  Nucleotide excision repair
clv04115  p53 signaling pathway
clv04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102087151 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    102087151 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102087151 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:clv04121]
    102087151 (DDB2)
   03400 DNA repair and recombination proteins [BR:clv03400]
    102087151 (DDB2)
Ubiquitin system [BR:clv04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     102087151 (DDB2)
DNA repair and recombination proteins [BR:clv03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      102087151 (DDB2)
SSDB
Motif
Pfam: WD40 GNAT_acetyltr_2
Other DBs
NCBI-GeneID: 102087151
NCBI-ProteinID: XP_005502228
UniProt: A0A2I0MNF4
LinkDB
Position
Unknown
AA seq 556 aa
MFSTWGLAAPNSDCAVGVLRIVAAAILPSGAGMAYGKQSAQVNKWLDRMTPVNQPKDKKH
ERAHEHCPEEAKSAGKRKLEYEQLGNEPQAKRLFVRKTSKPPEKIGWSRGGSVVRNNKVL
FHQLERQRSIVHYVYQNMLGGSIRAQLRQCLQLPFLRSLASYRLFRTASPFDRRVTCLEW
HPTHPSTVAVGSKGGDIILWDYEVLTKTCFIKGMGAGGAITGMKFNPFNPSQLYTSSVAG
TTTLQDFNGNTVRVFTSTEDWDCWYCSVDVSASCRAVVTGDNLGNVVLLSTSGEKIWKLK
LHRKKVTHVEFNSRCEWLMATASVDQTVKIWDLRNIKNKMNFLHVLPHDKPVNAAYFSPT
DGAKLLSTDQRSEIRVYSSSDWTKPQHLIPHPHRQFQHLTPIKATWHPRYDLIVAGRYPD
PKFPGYTVNELRTVDVFDGNTGEMVCQLHDPNASGIISLNKFNPMGDTLASGMGFNILIW
SREEMVAKKQEHLLKTMTEQGIGSWSLSRRGGQRQANPGTSKLKANLLPWELEEPRTKNN
DSKSQGRKRKGKDLEK
NT seq 1671 nt   +upstreamnt  +downstreamnt
atgttttccacttggggcctggctgcccccaattctgattgtgcggtgggggtgctacgt
atcgtggctgctgcgatcctgccctccggggctggaatggcttacggaaaacagagcgct
caggtaaacaagtggttagacaggatgactccagtgaaccagccaaaggacaagaagcac
gagagggcacatgagcattgtccggaagaggcaaaatcagctgggaagaggaaactggaa
tacgagcaactagggaatgagccacaagcaaagaggttgtttgtgagaaaaacatccaaa
cccccagagaaaatcggttggagtagaggtgggtctgtggtgagaaacaacaaagtcctt
ttccatcagctggagcgacagcgcagcattgttcattatgtctaccagaacatgctggga
ggctccattcgggcacagctcaggcagtgtctgcagctgccattcctgcgttctcttgcc
tcataccgcctctttcgaacagcaagtccctttgacaggagagtgacatgcctggaatgg
catccaacacaccccagtactgtagctgttggttccaaaggtggagacattatcctttgg
gactatgaagtacttactaaaacctgcttcatcaaagggatgggagctggaggggccatc
acaggaatgaagtttaacccttttaaccctagtcagctgtacacttcgtcagttgccggc
actaccaccctgcaggattttaatggcaatactgtccgggtcttcaccagcaccgaggac
tgggattgctggtactgcagcgttgatgtttctgcaagctgccgtgcagtggtgacaggt
gataatttgggcaatgtggtcctgctcagcacttctggtgaaaagatttggaagctgaaa
ttgcacaggaagaaggtgactcatgtggagtttaactcccgatgtgagtggttgatggcc
acagcatctgtagatcagacagtgaaaatctgggacctcagaaacatcaaaaacaaaatg
aattttcttcacgtacttcctcatgacaaacctgttaatgcagcttacttcagcccaaca
gatggtgccaagctcctaagcacagaccagcgcagtgaaatcagggtttattcatcttca
gactggaccaagccacagcatctgatcccacacccacatcgtcagtttcagcacctcacg
cctattaaggcaacatggcatcctcgctatgacctcattgtagcaggtcgctacccagac
cctaagttcccagggtacacagtgaacgagctacgaactgttgatgtatttgatggaaac
actggggagatggtttgtcagctccatgatccaaatgcttctggtatcatttcgctcaat
aaatttaaccctatgggagacacgctggcttctggcatgggttttaatattctgatctgg
agccgggaggagatggtggccaagaagcaagaacatcttttgaaaaccatgacagaacag
gggattggaagctggagtttgtccagacgtggagggcagaggcaggcaaaccctgggaca
agcaaactcaaagctaatttactgccttgggagctggaggagccgagaacaaaaaacaat
gattccaaatcacagggaaggaagcgaaaagggaaggatctagagaagtga

DBGET integrated database retrieval system