KEGG   Columba livia (rock pigeon): 102087399
Entry
102087399         CDS       T02912                                 

Gene name
FAS
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04060  Cytokine-cytokine receptor interaction
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04217  Necroptosis
clv05164  Influenza A
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102087399 (FAS)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102087399 (FAS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102087399 (FAS)
   04217 Necroptosis
    102087399 (FAS)
   04115 p53 signaling pathway
    102087399 (FAS)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    102087399 (FAS)
   05168 Herpes simplex virus 1 infection
    102087399 (FAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:clv04050]
    102087399 (FAS)
   04090 CD molecules [BR:clv04090]
    102087399 (FAS)
Cytokine receptors [BR:clv04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   102087399 (FAS)
CD molecules [BR:clv04090]
 Proteins
  102087399 (FAS)
SSDB
Motif
Pfam: Death TNFR_c6 DUF4508
Other DBs
NCBI-GeneID: 102087399
NCBI-ProteinID: XP_005503067
UniProt: A0A2I0LY92
LinkDB
Position
Unknown
AA seq 399 aa
MWTPKAGQRASLWAQSFIRHGCKGRRARRREPSHCSRASTAKLGQVVIFIIETRCKNNTE
ALIHTAYNKLITRRIIAKRETKCKLDEYISGDECCKKCERGFVKNVICPTDTTEHCVPCT
HGKDYMDHVNDLDKCLRCSSCDSIFGLAVAKNCTPERNTECTCAKNHFCNSSVPCRHCDP
CTICESGVTEKECTPTSDTVCRTEGVPAWAIALIILSVLFVPTAAILWWKRKQMGCTSKE
NLGEIIPITGVSCDNEPLIYPDIDLSSHVAGIVEQMTLTDVKTFVRHHQIPEPVIDQTLR
DNYPDTFEQKIKLFQVWYQRHGIKRAYGTLISSLRELKMCTVADQIEEKMKAAISSCQEG
GQSYGDDTEQSKTCNPRSTNSYNDSADLSKNNSGSLEET
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgtggacaccaaaagcaggacagagagcatccctgtgggcacagagcttcatcaggcac
ggctgcaagggcaggcgagcgaggaggcgggagccaagccattgcagcagggcgagtact
gctaagctggggcaggtagttatcttcataattgaaacacgatgcaaaaataatactgaa
gctctaatacacacagcttacaataaattaattacaaggaggatcattgctaagagggaa
actaagtgtaaactagatgaatacatttcaggtgatgagtgttgcaagaaatgtgaacgt
ggttttgttaaaaatgtcatctgcccaacagatactactgaacactgtgttccatgtaca
catggaaaggactatatggatcatgtcaatgatttggacaagtgtttgagatgctcttca
tgtgacagcatatttggtttggcagttgcaaagaactgcaccccggaacggaacacggaa
tgcacctgtgcaaagaatcatttttgcaattcttctgtaccatgtaggcactgtgatcca
tgtaccatatgtgaaagtggtgtaactgaaaaagaatgtactccaacttcagacactgtg
tgcagaacagaaggagtgccagcgtgggccattgctttaataattttgtcagtactattt
gtaccaactgcagcaatattgtggtggaagagaaaacagatgggttgtactagcaaggag
aacctgggtgaaataatccccataacaggggtttcttgtgacaatgaacctctcatatac
ccagatattgacctgagcagccatgttgctggtattgtggagcagatgacactcacagat
gtcaagacatttgttcgtcatcaccagataccagaacctgtcatagatcaaactcttcgg
gataattatcctgatacatttgaacagaagattaagttgtttcaagtctggtatcaaaga
catgggataaaaagagcctacggaaccctaataagcagcctgagagagcttaagatgtgc
actgtagctgatcaaattgaggaaaaaatgaaggcagccatttccagctgtcaggaaggg
ggacagtcttatggtgatgacactgagcaaagcaaaacctgcaatcccagaagtacaaac
tcttacaatgatagtgctgacctaagtaaaaacaactctggtagtctggaagagacatag

DBGET integrated database retrieval system