KEGG   Columba livia (rock pigeon): 102087532
Entry
102087532         CDS       T02912                                 

Gene name
GADD45B
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102087532 (GADD45B)
   04068 FoxO signaling pathway
    102087532 (GADD45B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102087532 (GADD45B)
   04210 Apoptosis
    102087532 (GADD45B)
   04115 p53 signaling pathway
    102087532 (GADD45B)
   04218 Cellular senescence
    102087532 (GADD45B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clv03036]
    102087532 (GADD45B)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102087532 (GADD45B)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102087532 (GADD45B)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102087532
NCBI-ProteinID: XP_013224765
LinkDB
Position
Unknown
AA seq 154 aa
MTLEELDAGGERGGGASEAVERVLVVAQRQDRLTVGVYESAKLMNVDPDSVVLCLLATDE
EDEGDIALQIHFTLIQAFCCDNDIHILRVSGMQRLAAILGEPEPGAEPRDLHCLLVTNPH
TDAWKSQGLAEVASYCAESRDKNQWVPYVCLQER
NT seq 465 nt   +upstreamnt  +downstreamnt
atgaccctggaggagctggatgcaggcggtgagcgaggcggtggagcgagcgaggcggtg
gagcgggtgctggtggtggcgcagcggcaggaccggctcacggtgggggtgtacgagtcc
gccaagctcatgaacgtggaccccgacagcgtggtgctgtgcctgctggccaccgacgag
gaggacgaaggcgacatcgccctgcagatccacttcaccctcatccaggctttctgctgt
gacaatgacatccacatcctgcgcgtctcgggcatgcagcgcctggcagccatcctgggc
gagcccgagccgggcgccgagccccgcgacctgcactgcctcttagtcacgaacccgcac
acggacgcctggaagagccaagggctggccgaggtggcgagttactgcgccgagagccgc
gacaagaaccagtgggtgccgtacgtctgtctgcaggagcggtga

KEGG   Columba livia (rock pigeon): 102090065
Entry
102090065         CDS       T02912                                 

Gene name
GADD45G
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
clv04210  Apoptosis
clv04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102090065 (GADD45G)
   04068 FoxO signaling pathway
    102090065 (GADD45G)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102090065 (GADD45G)
   04210 Apoptosis
    102090065 (GADD45G)
   04115 p53 signaling pathway
    102090065 (GADD45G)
   04218 Cellular senescence
    102090065 (GADD45G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clv03036]
    102090065 (GADD45G)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     102090065 (GADD45G)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     102090065 (GADD45G)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 102090065
NCBI-ProteinID: XP_005510628
LinkDB
Position
Unknown
AA seq 118 aa
GVYESAKLMNVDPDNVAFCVLAADEEDEGDIALQIHFTLIQAFCCENDIDIVRVNDVAKL
AAIVGPSEESGEPRDLHCILITNPNEDGWKDPALEKLNFFCEESRNVNDWVPTITLPE
NT seq 357 nt   +upstreamnt  +downstreamnt
ggcgtctacgagtcggccaagctgatgaatgtcgatcccgacaacgtcgcgttctgcgtg
ctggccgcggacgaggaggacgagggggacatcgccctgcagatccacttcaccctgatt
caggccttctgctgcgagaacgacattgacattgtgcgggtgaacgacgtggccaagttg
gcggccatcgtggggcccagcgaggaatctggggagccacgggacctccactgtatcctc
atcacgaatccaaatgaggatggctggaaggacccagctctagaaaagctgaactttttc
tgtgaagagagccgaaatgtaaatgactgggtgccaacaatcaccctgcctgagtga

DBGET integrated database retrieval system