KEGG   Columba livia (rock pigeon): 102087625
Entry
102087625         CDS       T02912                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04020  Calcium signaling pathway
clv04144  Endocytosis
clv04510  Focal adhesion
clv04540  Gap junction
clv04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102087625 (PDGFRA)
   04020 Calcium signaling pathway
    102087625 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102087625 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102087625 (PDGFRA)
   04540 Gap junction
    102087625 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102087625 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102087625 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:clv04090]
    102087625 (PDGFRA)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102087625 (PDGFRA)
Protein kinases [BR:clv01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102087625 (PDGFRA)
CD molecules [BR:clv04090]
 Proteins
  102087625 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE Kinase-like
Other DBs
NCBI-GeneID: 102087625
NCBI-ProteinID: XP_005501264
UniProt: A0A2I0MMJ2
LinkDB
Position
Unknown
AA seq 1087 aa
MGTSPRTFLILGCFLTGPFLTLCQLPLPTIVPNRNEMVVQLNSNFTLKCSGDSEVSWQYP
VTEGSHRIDIRHEENNSGLFVTVLEVGNASAAHTGLYVCYYNHTQVEDGEVEGKDIYIYV
PDPDMPFVPSIPEDQFILVEEGDPTVIPCRTSDPSAQVTLTNSLDKAVYAFYDSKQGFVG
NFPAGSYTCKTMVNGVEFKSDEFLIYILRATSQLPVEIEALKTVYKTGETIVVTCVVFDN
EVVNLQWNYPGKVKEKGLIKLDDIKVPSQKLVYTLTIPEASVKDTGDYECTARHATKEVK
ENKKVVITVHDKGFVHLEPQFSPLEAVNLHEVKNFVVDVQAYPAPKMYWLKDNVTLIENL
TEIVTSSNRVQETRFQSILKLIRAKEEDSGYYTLVAENEDEIKSYTFSLLIQVPALILDL
VDDHHGSAGGQTVRCLAEGTPLPDVEWLVCKDIKKCSNDTSWTLLTNNISDIHMEAHLDE
KNMVESQVTFQKVEETLAVRCVARNDLGAVTRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVIIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDNFLSRHPEKPKKDLDIFGMNPADENTRSY
VILSFENTGEYMDMKQADTTQYVPMLERKEGSKYSDIQRSVYDRPASYKKKSVSESEVKN
LLSDDSSEGLSLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDANYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATNEVYEIMVKCWNSEPEKRPSFYHLSEIVESLLPGEYKK
SYEKIHLDFLKSDHPAVTRMRGDCDNAYIGVTYKNEDKLKDRESGFDEQRLSADSGYIIP
LPDIDPVSEDELGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDSSD
LVEDSFL
NT seq 3264 nt   +upstreamnt  +downstreamnt
atgggcacttccccacggacgttcctgatcctgggatgttttctcacaggaccgttccta
acactttgccagcttcctctgccaactattgttcccaataggaatgaaatggtggtacag
ctgaattccaatttcacactcaaatgctccggagacagcgaagtgagctggcaataccca
gtgactgagggaagccacaggatagacattagacatgaggaaaacaacagtggcctcttc
gtgacagtgcttgaagtaggaaatgcctcagccgctcatacgggcttgtatgtttgctat
tataaccacactcaagtggaggatggggaagtggaagggaaggacatctacatctatgtt
cctgacccagacatgccttttgttccttctataccagaagaccagttcatcctagtagaa
gaaggtgatcccactgttatcccttgtcggacaagtgacccaagtgctcaagtgacttta
actaacagtttggacaaggctgtctatgctttctatgacagcaaacaaggttttgtaggg
aatttccctgcaggctcatatacatgcaaaacaatggttaatggtgtggagttcaagtcc
gatgagttcctcatctatattttaagagctacttcacagctgccagttgaaattgaagct
cttaaaactgtctacaaaacaggcgagaccatcgtagtaacttgtgtggtctttgacaat
gaggtggttaatttacagtggaattaccctgggaaagtgaaagaaaaaggtttgataaaa
cttgatgatatcaaagtcccatcacagaagctggtttacaccttgaccattcctgaggca
tcagtgaaagacacaggggattatgaatgtactgctcggcatgcgaccaaggaggttaag
gagaataagaaagtagtcattacagttcatgacaaagggttcgttcacctggagcctcag
tttagccctctggaagctgtcaatctacatgaagtaaaaaattttgtcgtcgatgtgcag
gcatacccagctccaaaaatgtactggttgaaggataacgtgactctgatcgaaaatctt
actgagattgttactagttcaaatagagtccaggaaacaaggtttcagagtatattaaaa
ttgatccgggccaaggaagaagacagtggatactacactttggttgctgaaaatgaagat
gagattaaaagctataccttctccttgctaatacaagttccagccctgattttagatctc
gtggatgatcaccatggctctgcaggggggcagaccgtgaggtgcttggcagaggggacc
ccgcttcctgatgtggaatggctggtttgcaaagacattaaaaagtgcagcaatgacacc
tcatggactcttttgactaacaatatctctgatatacacatggaagcccacctggatgag
aaaaacatggtggaaagccaggtgaccttccagaaggtagaggaaaccctggctgtgcga
tgtgtggcaaggaatgaccttggtgctgttactcgggaactgaagcttgtggctcctacc
ttgcgatcagaattaacggtggctgctgcagtcttagtgctgttagtgattgtgatcatt
tcactgattgtcctggtcatcatatggaaacagaagccaaggtatgagataagatggaga
gtcattgagtctatcagccctgatggccatgaatacatttatgtggacccaatgcaactg
ccttatgattccagatgggagtttcctcgagacgggttagtgcttggtcgaatccttggt
tctggagcatttggaaaagtagttgaaggaactgcttatggattgagtcgctctcagcca
gtgatgaaagtagctgtgaaaatgctgaaacctacagctagatccagtgaaaaacaggcg
cttatgtctgaactgaagataatgacgcatctcggcccccacctgaatattgtgaatctg
cttggagcttgtacaaaatcaggtcctatttacatcatcactgaatactgcttttatggc
gatttggtgaactatctgcataagaacagggacaatttcctgagccgacacccagagaag
ccaaagaaagatctggatatctttgggatgaacccagctgatgaaaacaccagaagttat
gtgatattatcatttgaaaacactggagaatacatggacatgaaacaagctgataccact
cagtatgtgccaatgctggaaaggaaggagggttctaaatactctgatattcagaggtct
gtttatgatcggcctgcttcatataagaagaaatctgtgtcagaatcggaagtcaaaaat
cttctttcagatgacagctcagagggcctcagcctactggatttgctgagcttcacctac
caggttgcacggggaatggaattcttggcttctaaaaattgtgtgcaccgtgacttggca
gctcgtaacgtcctcctcgctcaaggaaaaattgtgaagatctgtgacttcgggctggct
agagacatcatgcatgatgccaactatgtctccaagggcagtactttcctcccagtaaaa
tggatggcacctgaaagcatttttgacaatctgtacacaacattaagtgatgtctggtct
tatggcattctgctgtgggaaatattttctcttggtggcacaccatatcctggcatgatg
gttgactctactttctacaataagatcaagagtggataccgaatggccaaacccgatcac
gctaccaatgaagtgtatgagatcatggtgaagtgctggaacagtgaaccagagaaaaga
ccttctttttaccatctgagtgaaattgtggagagcttgttgcctggagagtacaaaaag
agctatgagaagattcacctggacttcctgaaaagtgatcacccagctgtcacacgcatg
agaggggactgcgacaacgcttacattggtgtcacctacaagaatgaggacaagttaaag
gacagagagagtggatttgatgagcagaggctgagtgctgacagcgggtacatcatcccc
ctgcctgacattgaccctgtttctgaggatgagcttggcaaaaggaataggcacagttcc
cagacatctgaagaaagtgccattgaaactggttccagtagctctactttcatcaagaga
gaggacgagaccattgaggacattgacatgatggatgacattgggatcgactcctcagac
ctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system