KEGG   Columba livia (rock pigeon): 102088195Help
Entry
102088195         CDS       T02912                                 

Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
clv  Columba livia (rock pigeon)
Brite
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    102088195
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102088195
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF TAF TFIID-31kDa Bromo_TP PAF
Motif
Other DBs
NCBI-GeneID: 102088195
NCBI-ProteinID: XP_005505469
UniProt: A0A2I0MJG1
LinkDB All DBs
Position
Unknown
AA seq 246 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRQASLALSVGGARLIMARTKQTARK
STGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQR
LVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARR
IRGERA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcagaggcaagggcgggaaggggctcggcaagggcggcgccaagcgccaccgc
aaggtgctgcgcgacaacatccagggcatcaccaagccggccatccgccgcctggctcgg
cgcggcggcgtcaagcgcatctcggggctcatctacgaggagactcgcggagtgctgaag
gtgttcctggagaacgtgatccgcgacgctgtcacctacaccgagcacgccaagaggaag
accgtgacagccatggacgtggtctacgccctcaagcgccagggacgccaagcctcctta
gccctctctgtcggtggagcaagactaataatggcgcgcacgaagcagacggcgcgtaag
tcgacgggcgggaaggcgccccgcaagcagctggccaccaaggctgcccgcaagagcgcg
ccggccaccggcggcgtgaagaagccgcaccgctaccggcccggcacggtggcgctgcgc
gagatccggcgctaccagaagtcgacggagctgctgatccgcaagctgcccttccagcgc
ctggtgcgcgagatcgcgcaggacttcaagaccgacctgcgcttccagagctcggccgtc
atggcgctgcaggaggccagcgaggcctacctggtggggctgttcgaggacaccaacctg
tgcgccatccacgccaagcgcgtcaccatcatgcccaaggacatccagctggcccgtcgc
atccgcggcgagcgcgcctga

DBGET integrated database retrieval system