KEGG   Columba livia (rock pigeon): 102088222Help
Entry
102088222         CDS       T02912                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00590  Arachidonic acid metabolism
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102088222 (PTGS1)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102088222 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 102088222
NCBI-ProteinID: XP_005513054
UniProt: A0A2I0M3Z1
LinkDB All DBs
Position
Unknown
AA seq 571 aa AA seqDB search
MLQTTAPVDPCCYYPCQHQGVCVRVGLAGYECDCTRTGYFGANCTSPEFWTRLRDLLKPS
PAFFHFILTHFTGLWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDYGYISWEAYANV
SYYTRILPPVPDGCPTPMGTKGKQQLPDPQLLAERFLLRQKFEADPRGTNLMFAFFAQHF
THQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFRDGKLKFQVVDGEMYPPM
VTDAPVHMVYPPGIPKERQLAMGQEVFGLLPGLSMYQTLWLREHNRVCDILKREHPTWGD
EQLFQTARLVLIGETIKIVIEDYVQHLSGYFLSLKFDPELLFGTQFQYRNRIAVEFNQLY
HWHGLMPDSFIIQGQEYSYEQFLYNTSMLMDYGVEALVESFSKQVAGRIGGGQTINANVL
QVAIGVIKESRQLRLXXXXXXXXKPYKSFQELTGEEEKAAELEELYGDIDALEFYLGLLL
EKPQPNGIFGESMVEIGSPFSLKGLLGNPICSPEYWKPSTFGGATGFEIVNSASLEKLVC
LNVKKCPYVAFQVPDAAENGSPRVGGSSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgctgcagacaacagcaccagtggatccttgttgctattacccctgccagcaccaaggg
gtgtgcgtgagggtcggcctggcaggatatgagtgtgactgcacgcggacgggatacttt
ggggccaactgcacctcccccgagttctggacgcgcctccgtgacctgctgaagcccagt
cctgccttcttccacttcatcctgacccacttcacggggctttgggacattatcaacagc
accttcatcagggacacgctcatgaggctcgtgctcacagttcgtgccaatctcatcccc
agcccccccactttcaactctgactatggctacatcagctgggaggcctacgccaacgtc
agctattacacccgcatcctcccgcccgtgccggacggctgccccacgcccatggggact
aaagggaagcagcagctccccgacccccagctcctggcggagaggttcctgctgcggcag
aagtttgaagctgatccccgaggcaccaatctgatgttcgccttcttcgcccagcatttc
acccaccagttcttcaagacgtctgggaagatgggacgtggcttcaccaaggcgctgggg
cacggggtggaccttgggcacttgtatggggacaacctgcagcggcagcaccagctgcga
ctcttcagagatgggaagctgaaattccaggtggtggatggagagatgtaccccccaatg
gtcaccgatgctccagttcacatggtctacccgcccggcatccccaaggagcggcagctg
gcgatggggcaggaggtgttcgggctgctgcccgggctctccatgtaccaaacgctctgg
ctgcgcgagcacaaccgtgtctgcgacatcctgaaacgggagcatcccacctggggcgac
gagcagctcttccagacagcgcgtctcgtcctcattggggagaccattaagattgtcatt
gaagattatgtccagcacctcagcgggtacttcctcagcctcaagtttgaccctgagctg
ctgtttgggacacagttccagtaccggaatcgcatcgcggtggagttcaaccagctctat
cactggcatgggctgatgcccgactccttcatcatccaggggcaagagtacagctatgag
cagttcctctacaacacctccatgctcatggactacggtgtggaggcgctggtggagtcc
ttttccaagcaggttgcaggaaggattggtgggggacaaaccatcaatgccaatgtcttg
caagtggccattggggtcatcaaggagtcccggcagctgaggctnnnnnnnnnnnnnnnn
nnnnnnnnnaagccctacaagtccttccaggagctgacaggagaggaagaaaaggcagca
gaactggaagagctgtatggagacatcgacgctctggagttctacctgggcttgctgctt
gagaaacctcaaccaaatggtatttttggagaaagcatggttgagatcggatctccgttt
tccctgaaggggcttctcggaaaccccatctgctccccagagtactggaagcccagtacg
tttggcggagcaactggctttgagatagtcaattcagcatcacttgagaaacttgtgtgc
ctcaacgtgaagaagtgcccatacgtggcgttccaggtgccagatgctgcagaaaatggc
agccctcgggttggtggatcatctgctgagctctag

DBGET integrated database retrieval system