KEGG   Columba livia (rock pigeon): 102088332Help
Entry
102088332         CDS       T02912                                 

Gene name
MAP3K14
Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04210  Apoptosis
clv04625  C-type lectin receptor signaling pathway
clv04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102088332 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102088332 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102088332 (MAP3K14)
   04672 Intestinal immune network for IgA production
    102088332 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102088332 (MAP3K14)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     102088332 (MAP3K14)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: STE group
  Other
   102088332 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Kdo
Motif
Other DBs
NCBI-GeneID: 102088332
NCBI-ProteinID: XP_005508263
LinkDB All DBs
Position
Unknown
AA seq 929 aa AA seqDB search
MAVMGITCQGAPDAAVKHKKELTATKGLNETVSEKQSSVCKVEDSKKVIFHSQWKILNDV
ITKGTAKEETEGGCASISIIAQAECENSQEFSPTLSERSFIAHSKRYSRSDSLDQIPNNV
AHATEGKMAPTCWRGRHRGKARKKRHKKRSKLKIQTVAAGRRGPRTPEQESCTPIPVQED
ESHENTLYRNHFWVSELNKDLVYEPFEKPEKALSAGKLHSPRSQYKTELHKLISPIQCLN
HVWKRRYQRDSVPQPEXIPPHFAHLDNPLHAVKRNALESYFHGQVYQDSEHRLSGLNSEY
SFPKCVNQSIKNSLDKISVEEYLVDALKGSVSLGEPQNLASLAKTWRGGGLDPKEQFHEA
DGNEGVLLTEKLKPVDYEYREEVHWTKCHGSLGIGSFGEVYKIEDKQTGFQCAAKKVQVE
HFRAEELTTCAAITSPNVVPLYGAVKEGPWVTIFMKLMEGGSLGQLIKQSGCLPEDRALS
YLGQALEGLEYLHAQNILHGDVKAENVLLSDDGSRALLCDFGHSAHLHPDGLGKCLVTGN
YVPGTETHMAPEVVMGKRCDSKVDVWSSCCMMLHMLNGCHPWTQYYNHPLCLKIAKEPPP
LREIPPSCNPLTAEIIKMGLEKEPVQRASASELKTKTSVALEEVGGVTSPWRGEYREPRH
LSLNKENNPQTSLSPTASPVSESASDPKLPGKVSCASPILPAPPSPEQREELERTPWNPC
KEFPETWDPPPLSSTPLPLKSCSHVERATTISEQELQQLEIELFLNSLSQPYSLEEQEQM
LSCLSIDSPFVSDASEKNSMKASHSLRDTMSSGIHSWNSQTDGQXXXXXPPRHTDTPSYF
NGVKIQIQLLSGENLHIRDFHRTKVGDIATGISSQIPVPAFSLVTKEGQPVRYDMEVPDS
GIELQCTLAPDCSVSWTWRVKHGQLENRP
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatgggaattacatgccaaggagctcccgatgcagccgtcaagcacaagaag
gagctcacagctacgaaggggctgaatgagacagtgagtgagaagcagagcagcgtttgc
aaagtagaagattcaaagaaggtcatctttcacagtcagtggaaaatcctgaatgatgtc
atcaccaaaggaacagcaaaagaagaaacagaaggaggctgtgcatccatttctattatt
gcccaagcagaatgtgaaaacagtcaggagttcagccccacattgtcagagagatccttt
attgctcacagtaagcgttacagccgatcggacagtctcgatcaaatccccaacaatgtg
gcccacgcgacggaggggaagatggcacctacctgctggcgagggcggcaccgcggcaag
gccaggaagaaacggcacaagaaaaggtccaagctgaaaatccaaacagtggctgctggc
aggagaggtcccaggactccagaacaagagagctgcaccccaattcccgtccaggaagat
gaatcacacgaaaacactctttacagaaaccatttttgggtttcagaacttaacaaggac
ttggtctatgagccgtttgagaaacctgagaaagctctgtccgcgggcaaactccattca
ccgaggagccaatacaaaactgaactgcacaagttaatcagcccaattcagtgccttaac
catgtttggaaacgacgctatcagagggacagcgttccgcagcctgaanncatcccccct
catttcgcacatctggacaatcctctccatgccgtgaaacgcaacgcgctggagtcgtac
ttccacggccaggtctatcaagacagcgagcatcgcttatctggcctaaactctgagtat
agtttccccaagtgtgtcaaccagtccataaaaaacagtttagacaagatttctgtggaa
gaatacttggtagacgccttgaaggggagcgtgagtcttggtgaaccccaaaatttagcc
agcctagccaagacgtggagaggaggaggcctggacccgaaggaacagtttcacgaagcg
gatggaaatgaaggcgtgctgctcactgagaaactaaagccggtggattatgagtaccga
gaagaggttcactggaccaagtgccacggttcgttgggcatcggctcttttggagaagtg
tacaaaatagaggacaaacagacggggtttcaatgtgctgccaaaaaggtacaagtggaa
cacttccgcgcagaggagttaacgacgtgtgctgcaataacgagccctaacgtcgtcccc
ttgtacggggcggtgaaggagggaccttgggtgaccatcttcatgaagctgatggagggt
ggctcattaggtcagctaattaaacagagcggctgcctgccggaggacagggccctcagt
tatttgggccaggctttagagggcttggagtatcttcatgctcaaaacattctccatgga
gatgtaaaagcggaaaacgtgctcttgtctgacgacggcagcagagctctcctgtgtgac
ttcggtcactccgctcacctgcaccctgacggcctggggaagtgcttggtcacagggaac
tacgtgccgggcacagagactcacatggctccggaggtggtgatgggaaagcgctgtgac
tccaaagtggacgtgtggagcagctgctgcatgatgctgcacatgctgaacgggtgccac
ccttggacccagtactacaaccacccgctctgcctgaagatcgctaaagagccacctcct
ctgagggaaattccaccttcctgcaaccctctcactgctgagattattaaaatgggtctg
gagaaagagcctgttcagagagcatctgcgtctgagctgaaaactaagaccagcgtcgca
cttgaagaagtgggaggtgtgacaagcccctggagaggcgaatacagagagcctcgccat
ttatctctgaacaaagagaacaacccacagacgtccctgtcccccacagcgagcccagtt
tctgagagtgcttctgacccaaagttgccaggcaaagtttcttgtgcgagccccatcctg
ccagcgccaccgtcgccagagcaaagggaggagctggagagaaccccttggaacccgtgc
aaggagttccctgagacctgggaccctccgcctctctcctccacccctctacccctcaag
agctgcagccacgtggagagagcaacaaccatttcagaacaagagcttcagcagctggaa
atagaactgtttttgaacagcctttcacagccttactcactggaagagcaagaacaaatg
ctttcgtgtctcagcatcgacagcccgtttgtgtcagatgccagtgagaagaactccatg
aaggcttctcacagcttgagggacacgatgagctctgggattcattcctggaacagccag
acagacggacagnannnnnnnnnnncccccccccgccacacagacactcccagctatttc
aacggagtgaaaatccagatccagttgctaagtggagaaaatttacacatcagggatttc
cacaggacgaaggtgggagacattgccactgggataagcagccagatcccggttcctgct
ttcagcctggtcaccaaggagggccagccggttcgctacgacatggaggtccccgactcc
ggcatcgagctgcagtgcaccctcgcgcccgactgcagcgtcagctggacgtggcgagtc
aagcacgggcagctggagaacaggccgtga

DBGET integrated database retrieval system