KEGG   Columba livia (rock pigeon): 102088487
Entry
102088487         CDS       T02912                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04012  ErbB signaling pathway
clv04068  FoxO signaling pathway
clv04150  mTOR signaling pathway
clv04270  Vascular smooth muscle contraction
clv04510  Focal adhesion
clv04810  Regulation of actin cytoskeleton
clv04910  Insulin signaling pathway
clv04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102088487 (BRAF)
   04012 ErbB signaling pathway
    102088487 (BRAF)
   04068 FoxO signaling pathway
    102088487 (BRAF)
   04150 mTOR signaling pathway
    102088487 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102088487 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102088487 (BRAF)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102088487 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    102088487 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102088487 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102088487 (BRAF)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102088487 (BRAF)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102088487 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 102088487
NCBI-ProteinID: XP_005500318
UniProt: A0A2I0MKF5
LinkDB
Position
Unknown
AA seq 715 aa
MIKLTQEHIEALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESMGNGTDFSVS
SSASTDTVASSSSSSLSVAPSSLSVYQSPADMSRNNPKSPQKPIVRVFLPNKQRTVVPAR
CGVTVRDSLKKALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPL
TTHNFVRKTFFTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVS
KFFEHHPIPQEEASLGETTPASGSYPSVPPSDSVGPPILPSPSPSKSIPIPQPLRPADED
HRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGLRGEGGSTAGLSATPPASLPGSLTN
VKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVY
KGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWC
EGSSLYHHLHIIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKI
GDFGLATVKSRWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTG
QLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILA
SIELLARSLPKIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgattaaattaacacaagaacatatagaggcactgctagacaaatttggaggagagcat
aatccaccatcgatatatttagaggcctatgaagagtacaccagcaaactagatgctcta
cagcagagagaacagcagctattggaatccatggggaatggaactgatttctctgtctct
agttcggcttcaacagacacagttgcatcatcttcctcctctagcctctctgtagcacct
tcatccctttcagtttatcaaagccctgctgatatgtcacggaataaccccaagtctcca
cagaagcctattgttagagtcttcctgcccaacaagcaaaggactgtggttccagcaaga
tgtggagtgacagtccgagacagcctaaagaaagctctgatgatgagaggtcttattcca
gaatgctgtgctgtttacagaatacaagatggagagaagaagccaattggctgggacact
gacatttcctggctcacgggagaagagttgcatgtggaagtcttggagaatgtgccactc
acaacacacaattttgtacgaaaaacattcttcacgttagcattctgcgacttttgtcga
aagctgcttttccagggattccggtgccagacgtgcggctacaaatttcaccagcgctgt
agtacagaagtgccactgatgtgtgtcaattatgaccaactcgatttgctgtttgtctcc
aagttctttgaacatcaccccataccgcaggaggaggcctcattaggagagaccacccca
gcatctggatcatacccctcagtgcccccctcagattctgttggaccaccaattctccct
agtccttctccttcaaaatccattccaatcccacagcccctccgaccagcagatgaagac
catcggaatcaatttgggcaacgcgaccgatcctcttcagctcccaacgttcacatcaat
acaatcgagccagtcaatattgatgacttgattagagaccagggtttacgaggagaggga
ggttcaactgcaggtttgtctgcaacacctcccgcctctttgcctgggtcactcaccaat
gtgaaagcgttacagaaatcaccaggaccccaacgggaaaggaaatcttcctcatcctca
gaagacagaaatagaatgaaaactcttggccgacgggattcaagtgatgattgggagata
ccggatggacagatcaccgttgggcaaaggataggatctggatcatttggaacggtctac
aaaggaaagtggcatggtgatgtggcagtgaaaatgttgaatgtcacggcacccacacct
cagcagttacaggctttcaaaaatgaagtaggagtgctcaggaaaacacgacatgtgaat
atcctgctttttatgggttattcaacaaaaccccagttggctattgttacacaatggtgt
gaggggtccagcttatatcaccatctacacatcattgagaccaaatttgaaatgatcaaa
ctaattgatattgcacgacagactgcacaaggcatggattacttgcatgccaagtcaatc
atccacagagacctcaagagtaataatatttttcttcatgaagacctcacagtaaaaata
ggtgactttggtctagctacagtgaaatcccgatggagtggatcccatcagtttgaacag
ctgtctggatctattctatggatggcaccagaagttatcaggatgcaagataaaaaccca
tatagctttcagtcggatgtgtacgcgtttgggattgttctttatgaattgatgactgga
cagttaccttactcaaacatcaacaacagggaccagataatttttatggtggggcgagga
tacttatctccagacctcagcaaagtacggagcaactgtccaaaagcaatgaagagacta
atggcagaatgcttgaaaaagaaaagagatgagagacccctttttccacagatacttgcc
tccattgagcttctggcccggtcattgccaaaaattcaccgcagtgcatctgagccctca
ttaaaccgggctggcttccagacagaggattttagtctatacgcttgtgcttctccaaaa
acacccatccaagcagggggatacggagaatttgcagcgttcaagtag

DBGET integrated database retrieval system