KEGG   Columba livia (rock pigeon): 102088650Help
Entry
102088650         CDS       T02912                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00590  Arachidonic acid metabolism
clv01100  Metabolic pathways
clv04370  VEGF signaling pathway
clv04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102088650 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102088650 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102088650 (PTGS2)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102088650 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 102088650
NCBI-ProteinID: XP_005511974
UniProt: A0A2I0LRH8
LinkDB All DBs
Position
Unknown
AA seq 571 aa AA seqDB search
MTTGFDQYECDCTRTGYYGENCTTPEFFTWLKVTLKPSPNTVHYILTHFKGAWNIINNVP
FLRDVIMRYVLTSRSHLIDSPPTYNSDYSYKNWEAYSNLSYYTRSLPPVGLDCPTPMGVK
GKKELPDSKLIVEKFLLRRKFIPDPQGTNVMFTFFAQHFTHQFFKTDHKKGPAFTKGLGH
GVDLNHIYGETLERQLKLRLLKDGKLKYQMIDGEMYPPTVKDTQAEMLYPPHVPEHLQFS
VGQEVFGLVPGLMMYATIWLREHNRVCDILKQEHPEWDDEQLFQTTRLVLIGETIKIVIE
DYVQHLSGYHFKLKFDPELLFNQRFQYQNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQ
FLYNNSIMLEHGLSHMVKSFSKQSAGRVAGGKNVPAAVQKVAKASIDQSRQMRYQSLNEY
RKRFMLKPFKSFEELTGEKEMAAELEELYGDIDAMELYPGLLVEKPRPGAIFGETMVEMG
APFSLKGLMGNAICSPEYWKPSTFGGKVGFEIINTASLQKLICNNVKGCPFTAFHVLNPE
PTEATINVSTSKTAMEDINPTLLLKERSAEL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgggatttgatcagtatgaatgcgactgcacgagaacaggatattacggagaa
aactgtacgacgccggaattcttcacgtggctgaaggtaacgttgaaaccgtcaccaaat
actgtccactacatcctcacacacttcaaaggagcctggaatatcatcaacaatgttccc
ttcttgcgagatgttattatgagatacgtattaacgtccagatcacacttgattgacagc
ccaccaacctacaacagtgattacagttacaaaaactgggaagcttattccaatctttcc
tattacacaagaagccttccaccagtaggacttgactgcccaacaccaatgggtgttaaa
ggcaagaaagagctcccagattcaaagctgattgtggagaagtttctgctacggcgaaaa
tttattcctgaccctcaaggcacaaatgtgatgttcacgttctttgcccagcacttcact
catcagttcttcaagacggaccacaagaaaggacctgccttcaccaaaggcctcggccac
ggggttgacttgaaccatatttatggagagactctggagagacaacttaaactgaggctt
ctgaaggatggaaagctaaagtaccagatgattgacggagaaatgtatcccccaacggtg
aaggacacccaggcagagatgctctaccctccgcacgtgccggaacacctgcagttctct
gtggggcaggaggtgtttggtttggtcccgggtctgatgatgtacgctacaatctggctg
agggagcacaaccgggtctgtgacatcctcaagcaggagcatccagagtgggatgacgag
cagctcttccaaacaactcgacttgtgttgataggagagacaatcaagatcgttatcgag
gactatgtgcaacacttgagcggctaccacttcaaactcaagttcgatccggagctgctg
ttcaaccagcgatttcaataccagaaccgcattgcagccgaattcaacactctctaccac
tggcacccgcttctgcccgacaccttccagatccacgaccaggaatacactttccagcag
ttcctctacaacaactccatcatgctggaacacggcctttcccacatggtgaaatccttc
tccaagcaaagtgctggcagggtcgctggtgggaaaaatgttcctgctgcagtacagaag
gttgcaaaggcctcgattgaccaaagtagacaaatgagataccagtccctgaatgagtac
aggaaacgcttcatgttgaaaccgttcaaatcatttgaagaacttacaggagaaaaagaa
atggcggctgaactggaagagctttacggagacatcgatgccatggagctgtatccaggc
ctccttgtggaaaagccgcggccaggcgccatcttcggcgagacgatggtggagatggga
gcgcccttctctctcaaaggactgatggggaacgccatctgctcccccgagtactggaag
ccgagcaccttcggcggcaaagtgggcttcgaaatcatcaataccgcctccttacagaag
ctcatctgcaacaacgtgaaaggctgtcccttcaccgccttccacgtcttaaaccccgaa
cccacagaggcgacgattaatgttagtacctcaaaaacagcaatggaagatatcaacccc
acactgcttctgaaagagcgatctgctgagttgtaa

DBGET integrated database retrieval system