KEGG   Columba livia (rock pigeon): 102088707
Entry
102088707         CDS       T02912                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04310  Wnt signaling pathway
clv04510  Focal adhesion
clv04520  Adherens junction
clv04916  Melanogenesis
clv05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102088707 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102088707 (CTNNB1)
   04520 Adherens junction
    102088707 (CTNNB1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    102088707 (CTNNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102088707 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 HEAT_2 Adaptin_N HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 102088707
NCBI-ProteinID: XP_021154280
LinkDB
Position
Unknown
AA seq 801 aa
MELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTTQVLYEWE
QGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAE
PSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHA
IMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAXXXXXSENAGVCGLLRL
YLSPVDSVLFYAITTLHNLLLHQEGAKMAVCLAGGLQKMVALLNKTNVKFLAITTDCLQI
LAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGM
QALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGI
LSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQN
AVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRA
HQDTQRRTSMGGTQQQFVVSGHGIYLDKLLIPSNFKKCLFFQSVRMEEIVEGCTGALHIL
ARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPL
TELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDI
GAQGEPLGYRPDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQ
DLMDGLPPGDSNQLAWFDTDL
NT seq 2406 nt   +upstreamnt  +downstreamnt
atggagttggatatggcgatggagccagacagaaaagcagcagtcagtcactggcagcaa
caatcatatctggactctggtatccattctggtgccacaacaactgctccctccttgagt
gggaagggaaatcctgaagaggaagatgtggacacgacacaagttctctacgagtgggag
cagggattctctcagtcctttacccaggagcaagttgctgatattgatggccagtatgca
atgactagagctcagagggtgcgtgcagctatgttccctgaaacgctggatgaaggaatg
caaatcccatccacacagtttgatgctgctcatccaactaatgtgcaacgcttggctgag
ccatcccagatgttaaaacatgctgttgttaatttgataaactaccaagatgatgctgag
cttgcaactcgtgcaatcccagaactgaccaaactgttgaatgatgaggaccaggtggtg
gtgaacaaggctgcagttatggttcatcagttatccaaaaaggaagcatctcgtcacgct
attatgagatctcctcaaatggtatctgctattgtacgtaccatgcaaaacacaaatgac
gtggaaacagcccgttgtactgcaggtacactacacaatctctcacatcaccgtgaaggc
ttgctggcaannnnnnnnnnnnnnagtgaaaatgctggggtatgtggactactaagactg
tacttgtctccggtggactctgtgctgttctacgccattacaactcttcacaatctcctt
ttacatcaggaaggagccaaaatggctgtctgtctagctggtgggctgcagaaaatggtt
gccttgctcaacaagacaaatgtcaaattcttggccatcacaacggactgccttcagatt
ttagcgtatggcaatcaagaaagtaagctgattattctggcgagtggtggaccccaggct
ctagtaaacataatgaggacctatacctatgagaaactattgtggaccacaagtagggtg
ctgaaggtgttgtcagtctgctccagcaacaaacctgctattgttgaggctggtgggatg
caagctttgggactccacctcacagatccaagccagcgtcttgtccagaactgtctctgg
actctgagaaatctgtcagatgctgcaacaaagcaggagggtatggaaggccttctagga
actcttgttcagcttttaggatcagatgatattaacgttgtgacttgtgctgctggtatc
ctctctaaccttacctgcaacaattacaagaacaagatgatggtgtgccaggttggtggc
attgaggctcttgtgcgcacagttcttcgggctggagacagggaagacatcacagaacct
gctatttgtgcgctccgtcacctcaccagcagacatcaagaagcagagatggctcaaaat
gctgtacgtctccattatggactcccagtggtggttaaactgttgcacccaccatcacac
tggcctttgatcaaggccactgttggtttgatccgcaatctggctctctgtcctgccaac
cacgccccgctgcgtgaacaaggtgctattccaaggctagttcagttgctggttagagca
catcaagatacccagcgacgtacttcaatgggtggaacacaacagcaatttgtggtaagt
ggccacgggatttatttggataaactgctgattcccagcaacttcaaaaaatgtcttttc
tttcaaagtgtgcgcatggaagaaattgttgagggctgcactggagccctgcatattctt
gcacgtgacgttcataatcgaattgtaatcaggggtctaaataccattccactatttgtg
cagttgttgtactcgcccattgagaacatccagagagtagctgcaggtgtactttgtgaa
ctggctcaagacaaggaagcagctgaagcaattgaagctgaaggtgcaactgccccttta
acagagctgcttcattctaggaatgagggtgttgcaacatacgcagctgcagtgcttttc
agaatgtctgaggacaaaccacaagactataagaagcgactttcagttgaattgacaagc
tctctgttcaggacggagccaatggcttggaacgagacagcagatcttggacttgatatt
ggtgcccagggagaacctcttggataccgcccagatgatcctagctaccgttctttccac
tctggcggatacggtcaggatgccttgggtatggaccctatgatggaacatgaaatgggt
ggccaccaccctggtgctgactacccagttgatggtctgccagatcttggccatgcccag
gaccttatggatgggctgcctccaggtgacagtaatcagttggcctggttcgatactgac
ctgtaa

DBGET integrated database retrieval system