KEGG   Columba livia (rock pigeon): 102088918Help
Entry
102088918         CDS       T02912                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00010  Glycolysis / Gluconeogenesis
clv00030  Pentose phosphate pathway
clv00051  Fructose and mannose metabolism
clv00052  Galactose metabolism
clv01100  Metabolic pathways
clv01200  Carbon metabolism
clv01230  Biosynthesis of amino acids
clv03018  RNA degradation
Module
clv_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102088918 (PFKP)
   00030 Pentose phosphate pathway
    102088918 (PFKP)
   00051 Fructose and mannose metabolism
    102088918 (PFKP)
   00052 Galactose metabolism
    102088918 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102088918 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:clv01009]
    102088918 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:clv03019]
    102088918 (PFKP)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102088918 (PFKP)
Protein phosphatases and associated proteins [BR:clv01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102088918 (PFKP)
Messenger RNA biogenesis [BR:clv03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102088918 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102088918
NCBI-ProteinID: XP_021145685
LinkDB All DBs
Position
Unknown
AA seq 728 aa AA seqDB search
MNAAVRAVVRMGIYVKAKVYFVYEGYQGMVDGGDNIVEVSWESVSSILQVGGTVIGSARC
KSFRTREGRLQAAYNLVQRGITNLCVIGGDGSLTGANLFREEWSGLLEELAQKEKIDEEA
VKKYAYLNIVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFIPEYPPEEGWEDSMCVKLSENRARKKRLNIIIVAEGAIDC
HNKPITSEKVKDLVVQRLGFDTRVTILGHVQRGGTPSAFDRILASRMGVEAVLALLEATP
ATPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDEGRFLEAVRLRGRSFENNLNTYKLLS
HKKPDAELPKTNFNVAVLNVGAPAAGMNAAVRAAVRVGITEGHKMFAVIDGFEGFARGKI
KEISWGDVGGWTGQGGSILGTKRTLPAKYLEKIADQMRTNNINALMVIGGFEAYESCLQL
HEARSRFEEFCVPICVLPATISNNVPGTDFSIGTDTALNAIVETCDHMGALAAGADAAYI
FEEQFDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCR
KNVLGHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKGKVFANTEDSVCLLGMRR
RNLVFQPVAELKTETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHSP
KEAETGAI
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgtgcgcgcagtagtacgcatgggaatctatgtaaaagccaaagtgtat
tttgtttatgagggttaccagggaatggttgatggaggtgataatattgtagaagtttca
tgggaaagtgtttcaagtatcctgcaagtgggcggtacagttattggaagtgcacgctgc
aaatcctttcgtacccgggagggccgcctgcaggcagcctacaacttggttcagagagga
atcactaatctttgtgtgattggcggagatggaagtttaactggggccaatcttttccgt
gaagaatggagtggacttctagaagaactggcacaaaaagaaaagattgatgaagaggct
gttaagaaatatgcttatcttaacattgtgggaatggttggatccatagacaatgacttc
tgtggcactgatatgaccataggtactgactcagccttgcacagaatcattgaagttgta
gatgccatcatgaccactgctcaaagccatcagaggacatttgttctggaggttatgggg
agacactgtgggtatctagctcttgttagtgccttagcctgcggcgcagattgggtcttt
attcctgaatacccaccagaagaaggatgggaagattcaatgtgtgttaagctttcagag
aatcgtgcacgaaagaaaagactgaacattattattgtagctgaaggagctattgattgc
cacaacaaacctataacatcagagaaggttaaggatcttgtggttcagcgacttggtttt
gacacccgagtaactatcctgggtcatgtgcaaagaggtggaaccccttcagcttttgac
agaattttggcaagtcgtatgggtgtggaagctgtgcttgcccttttagaagctactcca
gctaccccagcctgtgtcgtgtccctgtctggaaaccaggctgtccgtctgcctttgatg
gagtgtgtgcagatgactcaagaagtccagaaagccatggatgagggaagatttcttgag
gctgtgaggctgcgtggaaggagctttgaaaacaaccttaacacctacaaattactgtca
cacaaaaaaccagatgctgagcttccaaagactaattttaacgtggcagttttaaatgtt
ggtgctcctgcagctggaatgaacgctgcggtgagagctgcagtgagagttggcataact
gaaggccataaaatgtttgcagtcattgatggatttgaaggttttgctagagggaagata
aaggaaatcagctggggagatgttggaggctggactggtcaaggaggatcaattcttggt
acaaaacgtactcttcctgcaaaatatttggagaagattgctgaccagatgcgcactaac
aacattaacgccctgatggttattggtggatttgaggcctatgaaagttgtctgcagcta
cacgaggcacgttcccgctttgaggagttttgcgttcctatctgtgtgttgcctgcaact
attagcaacaatgtgccagggacagactttagcattggtactgacactgccctgaatgct
attgtggagacgtgtgatcatatgggggcccttgcagcaggagctgatgctgcttatatc
ttcgaagaacagtttgatattcgagagctccaggctaatgtggagcacctgactgaaaaa
atgaaaaccagtatccagcgtggtctagtgctgagaaatgagaactgcaatgagaactac
acaactgacttcatttatcagctgtattctgaagaaggaaaaggagtgtttgattgtaga
aaaaatgtcttgggccacatgcagcagggtggtgcaccttcaccgtttgatagaaacttt
gggacaaaaatatctgcaaaagctatgcagtggatctccaaaaaactgaaagaaacctac
cgaaaaggaaaagtatttgccaatactgaagactcagtttgtttgctgggaatgcgtaga
cgcaaccttgttttccaacccgtggctgagcttaagactgaaacagactttgtacacagg
attcccaaggagcaatggtggctgaagctgcgaccactgatgaaaatcctggccaaatac
aagactagttacgatgtctcagattccggccagctggagcacgttgctatgcacagccca
aaggaagcagaaaccggagccatctaa

DBGET integrated database retrieval system