KEGG   Columba livia (rock pigeon): 102089725
Entry
102089725         CDS       T02912                                 

Gene name
RRM2B
Definition
(RefSeq) ribonucleoside-diphosphate reductase subunit M2 B
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00230  Purine metabolism
clv00240  Pyrimidine metabolism
clv00480  Glutathione metabolism
clv00983  Drug metabolism - other enzymes
clv01100  Metabolic pathways
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102089725 (RRM2B)
   00240 Pyrimidine metabolism
    102089725 (RRM2B)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102089725 (RRM2B)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102089725 (RRM2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102089725 (RRM2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:clv03400]
    102089725 (RRM2B)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     102089725 (RRM2B)
DNA repair and recombination proteins [BR:clv03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102089725 (RRM2B)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 102089725
NCBI-ProteinID: XP_021135839
LinkDB
Position
Unknown
AA seq 373 aa
MTAGAEADGGAGCVQALRSPSGEAAARCPDSSSPRLSPSPSPNAAENGLDPDEEPLLRKN
PRRFVIFPIQYPDIWKMYKQAQASFWTAEEVDLSKDLPHWNKLKADEKYFISHILAFFAA
SDGIVNENLVARFSQEVQIPEARCFYGFQILIENVHSEMYSLLIDTYIKDPEKRDFLFNA
IETMPCVKKKADWALKWIEDRESTFGERVVAFAAVEGIFFSGSFAAIFWLKKRGLMPGLT
FSNELISRDEGLHCDFACLMFHYLVNRPSEERVHEIIVNAVEIEQEFLTEALPVGLIGMN
CTLMKQYIEFVADRLLMELGFSKVFHAENPFDFMENISLEGKTNFFEKRVSEYQRFAVMA
ETMDNVFTLDADF
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgacagctggtgcagaagcagatgggggtgctggctgtgtccaggccctgagaagccct
tctggagaggccgcagcgaggtgtcctgacagctcttcaccacggttgtctccaagcccc
tctccaaatgctgctgaaaatggcttggaccctgacgaggagcctcttctcagaaaaaat
ccccgccggtttgtcatcttccccatccagtacccagacatatggaaaatgtataaacag
gctcaggcctctttttggacagcagaagaggttgatttgtcgaaggaccttcctcactgg
aacaagctgaaagcagatgaaaaatactttatctctcatattctggcattttttgcagcc
agtgatggaattgtaaatgaaaacctggtggcacgttttagtcaggaggtgcagatccca
gaagctcgttgtttctatggctttcagattctcattgagaacgttcactcagagatgtac
agcttgctcatagacacctacatcaaagatcctgagaaaagggatttcttatttaatgct
attgaaacaatgccatgtgtcaagaagaaagcagactgggctctgaagtggattgaagac
agagaatccacttttggggagagagtggttgcctttgctgcagtcgaaggcatcttcttt
tcgggttcctttgctgctatattttggctgaagaagaggggcctgatgcctggattgact
ttctccaatgaacttattagcagagatgagggtctacactgtgattttgcttgtctaatg
ttccattatttagtgaacagaccatcagaagagcgggtccatgagatcatcgttaatgct
gttgaaattgagcaggagtttctaacagaggcattacctgtaggtctgattggaatgaat
tgcactttgatgaaacaatacattgaatttgttgcagaccggttgctaatggagcttggg
ttctccaaggtctttcatgcagaaaatccttttgatttcatggagaatatttctctggaa
ggaaaaacaaatttctttgagaagcgggtttcagaatatcaacgttttgctgttatggca
gaaacaatggacaatgtcttcactctggatgcagatttttga

KEGG   Columba livia (rock pigeon): 102098900
Entry
102098900         CDS       T02912                                 

Gene name
RRM2
Definition
(RefSeq) LOW QUALITY PROTEIN: ribonucleoside-diphosphate reductase subunit M2
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00230  Purine metabolism
clv00240  Pyrimidine metabolism
clv00480  Glutathione metabolism
clv00983  Drug metabolism - other enzymes
clv01100  Metabolic pathways
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102098900 (RRM2)
   00240 Pyrimidine metabolism
    102098900 (RRM2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102098900 (RRM2)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    102098900 (RRM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102098900 (RRM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:clv03400]
    102098900 (RRM2)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     102098900 (RRM2)
DNA repair and recombination proteins [BR:clv03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    102098900 (RRM2)
SSDB
Motif
Pfam: Ribonuc_red_sm
Other DBs
NCBI-GeneID: 102098900
NCBI-ProteinID: XP_021149256
LinkDB
Position
Unknown
AA seq 392 aa
MLSSRVPLATRHDQPSVSPRKGLSPLKNLSLSDKENTPPALSSARVLASKAARKIFQEGD
GKPVPRDAEEEEPLLRENPRRFVVFPIQYHDIWQMYKKAEASFWTAEEVDLSKDIQHWES
LKPEEKYFISHVLAFFAASDGIVNENLVSVYGQSXQKHHFVKCFYGFQIAMENIHSEMYS
LLIDTYIKDSKEREFLFNAIETLPCVKKKADWAMRWIGDKKATYGERVVAFAAVEGIFFS
GSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLIHKPSEERVKEIIMNAV
LIEQEFLTEALPVKLIGMNCTLMKQYIEFVADRLMLELGFNKIYKVENPFDFMENISLEG
KTNFFEKRVGEYQRMGVMSKPTDNSFTLDAEF
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgctgtcttctcgcgtcccgctcgccacccgccatgaccagcctagcgtgtcccctcga
aagggcctgtcgcccctgaagaacctatcgctgagcgacaaggagaacacgccccccgcg
ctcagcagcgcccgcgtcctggccagcaaggcggcccgcaagatcttccaggagggcgac
gggaagccggtgccccgggacgcggaagaggaggagccgctgctgcgggagaacccccgc
cggttcgtcgtcttccccatccagtaccacgacatctggcagatgtacaagaaggccgag
gcctccttctggacggcggaggaggtggatctttcaaaagacatccagcactgggagtcc
ctgaagcccgaggagaagtacttcatttctcacgtccttgccttctttgcagccagtgat
ggcatcgttaatgaaaacctggtaagtgtgtatggacagtcctgacagaagcatcacttt
gtgaaatgtttctatggcttccagattgccatggaaaacatacattcagaaatgtacagt
cttcttatcgacacctacattaaggattctaaagagagggaatttcttttcaatgctatt
gaaacattaccgtgtgttaaaaagaaggctgactgggccatgcgctggattggggacaag
aaagcaacatatggagaacgtgtagtagcttttgcagcggtggaaggaatcttcttttct
ggctcttttgcatcaattttttggctgaagaaaaggggattaatgcctggactcactttt
tctaacgaactcatcagcagagatgagggcttgcactgtgattttgcctgtctcatgttc
aagcacttgatacacaaaccatcagaggagagagtaaaggaaataatcatgaatgctgtt
ctcatagaacaggaattcttgacggaggcactgcctgtaaagctgatcggcatgaactgc
actttaatgaaacagtacatagagtttgtagcagaccggcttatgttggaactgggattt
aacaagatatacaaagtggagaatccttttgacttcatggaaaacatctctctggaaggc
aagaccaatttctttgagaagcgagtaggtgaatatcagcggatgggagtcatgtcaaag
cccacggacaactccttcaccctggatgcagaattttaa

DBGET integrated database retrieval system