KEGG   Columba livia (rock pigeon): 102089742
Entry
102089742         CDS       T02912                                 

Gene name
SIAH1
Definition
(RefSeq) E3 ubiquitin-protein ligase SIAH1 isoform X1
  KO
K04506  E3 ubiquitin-protein ligase SIAH1 [EC:2.3.2.27]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04120  Ubiquitin mediated proteolysis
clv04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102089742 (SIAH1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    102089742 (SIAH1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102089742 (SIAH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:clv04121]
    102089742 (SIAH1)
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102089742 (SIAH1)
Ubiquitin system [BR:clv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   SINA (Seven in absentia) proteins
    102089742 (SIAH1)
SSDB
Motif
Pfam: Sina
Other DBs
NCBI-GeneID: 102089742
NCBI-ProteinID: XP_005504740
UniProt: A0A2I0M2J2
LinkDB
Position
Unknown
AA seq 320 aa
MALATAASTGRCVLMPTRTVFLDLQQANLKFSPSLSLEMSRQTATALPTGTSKCTPSQRV
PALTGTTASNNDLASLFECPVCFDYVLPPILQCQSGHLVCSNCRPKLTCCPTCRGPLGSI
RNLAMEKVANSVLFPCKYASSGCEITLPHTEKADHEELCEFRPYSCPCPGASCKWQGSLD
AVMPHLMHQHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGFHFMLVLEKQEKYDGH
QQFFAIVQLIGTRKQAENFAYRLELNGHRRRLTWEATPRSIHEGIATAIMNSDCLVFDTS
IAQLFAENGNLGINVTISMC
NT seq 963 nt   +upstreamnt  +downstreamnt
atggccttggcgacggctgcatcaacaggtcggtgcgttctgatgccgacaaggacagtt
tttcttgatctacaacaagcaaatcttaaattttccccttcactttctcttgagatgagc
cgtcagacggcgaccgcgctgcccacgggtacgtccaagtgcacgccgtcgcagcgggtg
cccgcgctgaccggcaccaccgcctccaacaatgacctggcgagcctcttcgagtgcccc
gtgtgcttcgactatgtgctgccgcccatcctgcagtgtcagagcggccacctcgtctgt
agcaactgtcgccccaaactcacgtgctgcccgacttgccgtggcccgctgggctccatc
cgcaacctggccatggagaaagttgccaattctgtactattcccgtgtaaatacgcctcg
tccggctgcgagataactttgccgcacacggaaaaagcagaccacgaggagctgtgcgag
ttcaggccttactcctgcccgtgccccggtgcctcgtgtaaatggcagggctccctggat
gccgtgatgccgcacctgatgcatcagcacaagtccatcaccacgctgcagggagaagac
atcgtgttcctcgccacagacattaacctccctggtgctgttgactgggttatgatgcag
tcttgttttggctttcatttcatgttagtattggagaaacaggagaagtatgatggtcac
cagcagttctttgcgatcgtacagctgataggaacccgcaagcaagcggaaaactttgcg
tatcggctcgagctgaacggtcacaggcggcgactgacttgggaggcgactcctcgctcc
attcacgagggaatcgcgacagccatcatgaatagtgactgcctagtctttgacaccagc
atcgcacagctctttgcagaaaacggcaatttaggcatcaacgtaactatatccatgtgt
tga

DBGET integrated database retrieval system