KEGG   Columba livia (rock pigeon): 102090104
Entry
102090104         CDS       T02912                                 

Gene name
RCHY1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:clv00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102090104 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102090104 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:clv04121]
    102090104 (RCHY1)
Enzymes [BR:clv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102090104 (RCHY1)
Ubiquitin system [BR:clv04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    102090104 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-C3HC4_3 Prok-RING_4 zf-RING_11 zf-RING_4 zf-CHY zf-RING_5
Other DBs
NCBI-GeneID: 102090104
NCBI-ProteinID: XP_005502583
LinkDB
Position
Unknown
AA seq 255 aa
MVVPSPSRHVGEGSATMAVPCGRRAQGRVPVVAPRQAQQRCEGCHNLFGEYYCSICHLFD
RDKQQYHCAECGICRIGPKEDFFHCSKCNLCLSLSLLGKHKCIENVSRQDCPICLEDIHT
SRVGAHVLPCGHLLHRTCYEDMLKEGYRCPLCMRSALDMTRYWRQLDDEVALTPMPPEYQ
NMMVQILCNDCNARSTAQFHLLGMKCGNCDSYNTAQDGTCRLAGKKKGPPRRTATSALLA
NKRTQRSHGDGWNVV
NT seq 768 nt   +upstreamnt  +downstreamnt
atggtggtgccgtctcccagccgccatgttggtgagggcagcgctaccatggccgtgccg
tgcggccggagggctcagggccgtgtccctgttgtcgccccccggcaggcccagcagcgc
tgcgagggctgccacaacctcttcggcgagtactactgcagcatctgccacctgttcgac
cgcgacaagcagcagtaccactgcgccgagtgcgggatctgcaggattgggccgaaggag
gattttttccactgttcaaagtgcaacttgtgcctgagcttgagtcttcttggaaagcac
aagtgcatcgagaacgtgtcgaggcaggactgcccgatatgtctggaggacatccacacg
tcccgcgttggcgctcacgtcctgccctgcggtcacctcctgcacagaacgtgctacgag
gacatgctgaaggagggttacaggtgtccgctctgcatgcgctcggcgctggacatgacg
cggtactggcggcagctggatgacgaggtggcgctgacccccatgccccccgagtaccag
aacatgatggtgcagatcctgtgcaacgactgcaacgcccgctccacggcgcagttccac
ctgctgggcatgaagtgcggcaactgcgactcgtacaacacggcgcaggacgggacctgc
cggctggcgggcaaaaaaaaggggcctccccgccgcacagcgacgagcgcgctcctcgct
aataaacgcacacaacgctctcacggcgacgggtggaacgtggtttaa

DBGET integrated database retrieval system