KEGG   Columba livia (rock pigeon): 102090191
Entry
102090191         CDS       T02912                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X2
  KO
K04692  signal transducer and activator of transcription 3
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04068  FoxO signaling pathway
clv04217  Necroptosis
clv04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102090191 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102090191 (STAT3)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102090191 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:clv03000]
    102090191 (STAT3)
Transcription factors [BR:clv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    102090191 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR Fib_alpha Tropomyosin_1
Other DBs
NCBI-GeneID: 102090191
NCBI-ProteinID: XP_005513646
UniProt: A0A2I0LK26
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQATHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRGIVSELAGLLSAMEYVQKMLADEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGITFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRSESQEHSEATDSGAAPYLKTKFICVTPTSFSN
TIDLPMSPRTLDSLMQFGNSSEGAEANAGGQFESLTFDMEMTPECASSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcgcagtggaaccagctgcagcagctcgacacgcggtacctggagcagctccaccag
ctctacagcgacagcttccccatggagctgcggcagttcctggccccatggattgagagc
caggactgggcctatgctgccagcaaggagtcccacgccacgctggtgttccacaacctg
ctgggagagatcgaccagcagtacagccgctttctgcaggagtccaatgtcttgtaccag
cacaacctgcgccgcatcaagcagttcctgcagagcaggtacttggagaagccgatggaa
atagcccgcatcgtggctcgctgcctgtgggaagagtcgcggctcctccagacggctgct
accgcagcccagcaagggggacaggcaacacatccaacagcagctgtggtgacggaaaag
cagcagatgctggagcagcatctgcaggatgtgaggaagagggtgcaggatctggagcag
aagatgaaagtggtggagaatctccaggatgactttgattttaactacaagactttgaaa
agccaaggagacatgcaggatctgaatggaaacaaccagtcagtgacccggcagaaaatg
cagcagctggagcagatgctgacggcgctggaccaaatgcgaagggggattgtgagcgag
ctggctgggctgctctcagccatggagtacgtgcagaagatgctggcagacgaggagctg
gcagactggaagagacggcaacagatcgcctgcattggcggcccacccaatatctgctta
gaccggctggagaactggataacctctcttgccgaatcgcagctacagacccggcagcag
atcaagaaattggaagaactgcagcaaaaagtgtcctacaagggtgaccccattgtccaa
caccggcccatgctggaggagcggatcgtggagctgttcaggaacctgatgaagagcgct
tttgtcgtggagaggcagccctgcatgcccatgcaccccgaccggcccctggtcatcaaa
accggtgtgcagttcaccaccaaagtcaggttgttggtcaagtttccagagctgaattat
cagctgaaaattaaagtctgcattgacaaggactctggggatgttgcagcacttcggggg
tcgcggaagtttaacatcctggggacgaacacaaaggtcatgaacatggaagagtccaac
aacgggagcctctcagcggagttcaagcacctgaccctgcgggagcagcgctgcggtaat
ggaggcagagccaactgtgatgcctcgctgatagtcaccgaggagctgcatctcatcacc
tttgagacagaggtgtatcaccaggggctgaagattgacctggagacgcactcgctgcct
gtggtggtcatctccaacatctgccagatgcccaacgcctgggcgtccatcctgtggtac
aacatgctgaccaacaaccccaagaacgtgaacttcttcaccaagccccccattgggacc
tgggaccaggtggcagaggtgctgagctggcagttctcctccaccacgaaacgtggcctc
agcatcgagcagctgacaacgctggcagaaaaacttctggggcctggtgtgaattactcc
ggctgtcagatcacttgggccaagttctgcaaggagaacatggctggcaaaggtttctct
ttctgggtctggctggacaacatcattgacctggtgaaaaagtacatcctggcgctgtgg
aacgaagggtacatcatggggttcatcagcaaggagcgggaacgagccatcctgagcacc
aaaccaccgggaaccttcctgctgcgcttcagtgagagcagcaaggaaggcggcatcacc
ttcacgtgggtggagaaggacattagtgggaagacccagatccagtctgtggaaccttac
accaagcagcagctgaacaacatgtcattcgccgagatcatcatgggctacaaaatcatg
gatgccaccaacatcctggtgtcccccctggtgtacctgtacccggacatccccaaggag
gaggcgtttgggaagtactgccgctccgagagccaggagcactcggaagccaccgactca
ggtgccgctccatatctgaagaccaaattcatctgtgtcacccccacctccttcagcaac
accatcgacctgcccatgtccccgcgcaccctggactcgctcatgcagtttggcaacagc
agcgagggagcggaggccaacgccggggggcagtttgagtcgctgacgtttgacatggag
atgacccccgagtgcgcttcttcacccatgtga

DBGET integrated database retrieval system