KEGG   Columba livia (rock pigeon): 102090362Help
Entry
102090362         CDS       T02912                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00052  Galactose metabolism
clv00500  Starch and sucrose metabolism
clv01100  Metabolic pathways
clv04142  Lysosome
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102090362 (GAA)
   00500 Starch and sucrose metabolism
    102090362 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102090362 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clv04147]
    102090362 (GAA)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102090362 (GAA)
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102090362 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N
Motif
Other DBs
NCBI-GeneID: 102090362
NCBI-ProteinID: XP_013224417
LinkDB All DBs
Position
Unknown
AA seq 718 aa AA seqDB search
MHIYIYSCSAGDCGLNTTVAPLFFADQFLQISTSLPSCFISGLGEHLTPLVLNMTWTRIT
LWNRDVAPVPHVNLYGSHPFYLGMEDGGLAHGVFLLNSNAMDVLLQPSPALTWRTTGGIL
DFYVFLGPDPKSVVRQYLPLPGFPFMPPYWGLGFHLCRWGYSSTDITRQVVANMSAARFP
LDVQWNDLDYMDAKRDFTFSKTSFKDYPQMVQDFHQHGLRYIMIVDPGISSSGPPGTYRP
YDEGLRRGVFIRNATGQPLIGKVWPGPTVFPDFTNPETHEWWHDMVKDFHDQVPFDGMWI
DMNEPSNFVEGSQDGCPNSSLEQPPYVPGVFGGRLRAGTICASSQQYLSSHYNLHSLYGL
TEAIASHNALLRVRGTRPFVISRSTFAGHGRYAGHWTGDVSSNWEQLYYSIPEILLFNLF
GVPLVGADICGFVGDTSEELCVRWTQLGAFYPFMRNHNAHGARPQEPYVFSPAAQAAMRN
ALRLRYSLLPFLYTLFHRAHSAGDTVARPLFLEFPEDPNTWAVDRQLLWGGGLLVTPVLE
AGQTKVSGYFPAGLWGCCTGDSTIHSKGQWILLPAPLDTINVHVRAGHILPLQEPAFSTA
ESRGKGMALVVALTPDGFARGDLFWDDGESWQSFEKGDYTEILFLATHGAVLSQLLRVGT
HLDGVLLEAVTVLGVTSPPRQVLANGALVSDFSYRSDTQVLRVPVSLPMWEQFVIAWS
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atgcatatatatatatattcttgttctgctggagactgcgggctgaacaccaccgtcgca
cccctcttcttcgcagaccagttcctgcagatctccacctccttgccctcctgtttcatt
tctgggctgggggaacacctgacgccgctggtcctcaacatgacgtggaccaggatcacc
ctctggaatcgggacgtggcacctgtgccccacgtcaacctctacggctcccaccctttc
tacctggggatggaggacggcggtttggcccatggtgtctttctgctgaacagcaacgca
atggacgtgctcctgcagcccagcccggccctgacctggcgcacgacgggcgggatcctg
gacttctacgtgttcctgggccccgaccccaagagcgtggtgcggcagtacctcccgctt
ccagggttccccttcatgcccccgtactggggcctgggcttccacctctgccgctggggc
tactcctccaccgacatcacccggcaggtcgtggccaacatgtcggcagcccgcttcccg
ctggacgtgcagtggaacgacctggattacatggatgccaagagagatttcaccttcagc
aagacaagctttaaggactacccgcagatggtgcaggacttccaccagcacggcctgagg
tacatcatgatcgtggatcccgggatcagcagttcagggcctcccggcacctacaggcca
tacgacgaggggctgaggcgaggggtgttcattcgaaatgccacggggcagcccctgatc
gggaaggtctggccgggcccaacggtcttcccggacttcaccaacccggagactcacgag
tggtggcacgacatggtgaaggacttccatgaccaagtgcccttcgatggcatgtggatt
gacatgaacgagccatcgaactttgtggagggctcccaggacggctgccccaacagcagc
ctggagcagcccccctatgtgccaggtgtgttcgggggccggctccgggccgggaccatc
tgtgcgtccagccagcagtacctgtcttcccactacaacctgcacagcctgtacgggctg
accgaggccatcgcctctcacaacgcgctgctcagggtccggggcacgcggccctttgtc
atttcgcgctccacattcgctgggcacgggcgctacgcggggcactggacaggggacgtc
agcagcaactgggagcagctctattactccattccagagatcctgctcttcaacctcttc
ggggtgccgctggtgggtgccgacatctgcggcttcgtgggtgacacgtccgaggagctg
tgtgtgcgctggacccagctgggcgccttctaccccttcatgaggaaccacaacgcccac
ggtgcccggccgcaggagccgtacgtcttcagcccggccgcccaggccgccatgcgcaac
gccctgcgcctccgctactccctcctgcccttcctctacaccctgttccaccgcgctcac
tctgctggggacacggtggcacggcccctcttcctcgagttccccgaggaccccaacacc
tgggccgtggaccggcagctgctgtggggcggggggctgctcgtcactcctgtgctggag
gccggacagaccaaagtcagcggctacttccccgcggggctctggggttgctgcacgggg
gactccaccatccacagcaaagggcagtggatcctcttgccagctcccctggacaccatt
aacgtccacgtccgtgcagggcacatcctgcccctgcaggaacccgcgttcagcactgcc
gagtcccgcgggaaggggatggccttggtggtggcactgacaccggacggcttcgccagg
ggagacctgttctgggatgacggggagagctggcagagctttgagaagggagactacact
gagatcctcttcctggccacgcacggcgccgtgctgagccagctcctgcgggtgggcacc
cacctcgacggggtcctgctggaggccgtgaccgtgctgggtgtcaccagccctccccgg
caggtcctggccaacggtgccctcgtgagcgacttctcctaccgcagcgacacccaggtg
ctgagagtccccgtgtcgctgcccatgtgggagcagtttgtgatcgcgtggtcctga

DBGET integrated database retrieval system