KEGG   Columba livia (rock pigeon): 102090439
Entry
102090439         CDS       T02912                                 

Gene name
TP73
Definition
(RefSeq) tumor protein p73 isoform X2
  KO
K10148  tumor protein p73
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102090439 (TP73)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:clv03000]
    102090439 (TP73)
Transcription factors [BR:clv03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   p53
    102090439 (TP73)
SSDB
Motif
Pfam: P53 P53_tetramer SAM_2 SAM_1
Other DBs
NCBI-GeneID: 102090439
NCBI-ProteinID: XP_005514390
LinkDB
Position
Unknown
AA seq 592 aa
MLYISDPMQHYTTSQFNLLNNSMDQSIGSRAASTSPYSSEHTSNVPTHSPYSQPSSTFDA
MSPAPVIPSNTDYPGPHHFEVTFQQSSTAKSATWTYSPLLKKLYCQIAKTCPIQIKVSTP
PPPGTIIRAMPVYKKAEHVTEVVKRCPNHELGRDFNDGQAAPASHLIRVEGNNLSQYVDD
PVTGRQSVMVPYEPPQVGTEFTTILYNFMCNSSCVGGMNRRPILIIITLETRDGQVLGRR
SFEGRICACPGRDRKADEDHYREQQALNESASKNGNNNKRTFKQSPQGIPALGAGIKKRR
HGEEEMYYVPVRGRENFEILMKIKESLELVELVPQQLVDSXXXXXAPSHPDRPLIPLRRS
QLQTSASYGPVLSPMNKVHSGGINKLPSVNQLVGQAAQHGPGSAPGLAPMGPGMLNSHPM
QPNGEMNGGHSSQSMVSGSHCTPPPPYNPDPSLVSFLTGLGCPNCIDYFTSQGLQNIYHL
QNLSIEDLGALKIPEQYRMIIGRGLQELKQSHEYGAQPLLRSSSNAASISIGSSGELQRQ
RVMEAVHFRVRHTITIPNRGAADDWADFGFDLPDCKSRKQSIKEEFTEGEIN
NT seq 1779 nt   +upstreamnt  +downstreamnt
atgctgtacatcagcgacccgatgcagcattacaccacgtcccagttcaatttgctgaac
aacagcatggatcagagcatcggcagcagagcagcctccaccagcccctacagctccgag
cacacctccaatgtcccaacgcattcgccctactcgcagcccagctcgaccttcgacgcc
atgtccccagctcccgtcatcccctccaacactgactaccctggtccccaccactttgag
gtgacgttccagcaatccagcaccgccaagtcggccacctggacatactcccccctgctg
aagaaactctactgccagattgcaaaaacatgtcccatccagatcaaggtgtccaccccc
ccgccgccaggcaccatcatccgggccatgcccgtctacaagaaggcagagcacgtcacc
gaggtggtgaaacgctgccccaaccacgagctcggccgcgacttcaatgacggccaggca
gcccccgccagccacctcatccgcgtggaaggcaacaacctgtcccagtacgtggacgac
ccggtgacgggacgacagagcgtgatggtgccctacgagcccccacaggtgggcaccgag
ttcaccaccatcctgtacaacttcatgtgcaacagcagctgcgtgggagggatgaacagg
aggcccatcctcatcatcatcaccctggagaccagagatgggcaggtcctcgggaggaga
tcgttcgagggacggatctgtgcctgtccgggcagggaccgcaaggccgatgaagaccat
taccgggagcagcaagccctgaacgagagcgcatccaagaatggcaacaacaacaagcgc
accttcaagcagagcccacagggcatcccagcgctgggcgccggcattaagaagcggagg
cacggcgaggaggagatgtattacgtgcctgtgcgaggccgggagaacttcgagatcctg
atgaagataaaggagagcctggagctggtggagctggtcccgcagcagctggttgactcc
tnnnnnnnnnnnnnggctccatcccaccccgaccgtccgctcattcccctgcgcaggagc
cagctgcagacatcggcctcctacggccccgtcctctcgcccatgaacaaggttcacagc
gggggaatcaacaagctgccgtcggtcaaccagctggtggggcaggcggcgcagcacggc
cccggctccgcgcccggcctggcacccatgggacctgggatgctgaacagtcaccccatg
cagcccaacggggagatgaacgggggccactcgtcacagtccatggtgtcgggatcgcac
tgcacgcccccgccgccctacaaccccgaccccagcctcgtcagttttttaacaggattg
gggtgtccaaactgcatcgactatttcacctcacaagggttacagaatatttaccacctg
cagaacctatccatagaggatctcggagcactgaagatcccggagcagtacaggatgatc
atcgggcgcgggctgcaggagctgaagcagagccacgagtacggggcgcagccgctgctc
cgctccagcagcaacgccgccagcatctccatcggcagctcgggcgagctgcagcggcag
cgcgtgatggaggccgtgcacttccgcgtgcgccacaccatcaccatccccaaccgcggc
gcggccgacgactgggccgacttcggcttcgacctcccggactgcaaatcccgcaaacag
tccataaaggaggagttcacggagggagagatcaactga

DBGET integrated database retrieval system