KEGG   Columba livia (rock pigeon): 102090495Help
Entry
102090495         CDS       T02912                                 

Gene name
HDAC10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
clv  Columba livia (rock pigeon)
Brite
KEGG Orthology (KO) [BR:clv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:clv03036]
    102090495 (HDAC10)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102090495 (HDAC10)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102090495 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102090495
NCBI-ProteinID: XP_021154063
LinkDB All DBs
Position
Unknown
AA seq 641 aa AA seqDB search
MFTFCLKYECWDICFVLCVAMASGTALVYDEEMTTHKLLWSDPVCDIEVPERLSSSYEQL
KCYHLVERCVHVPAREGSEEEILLVHSSEHLEMAKSTQTMNEKELKRVSGNYDAFFFHPN
TYRCARLAVGATLQLVDAVMTGKVCNGMALVRPPGHHSQKNAANGFCLFNNVAIAAEYAK
LKYGLQRILIVDWDVHHGQGTQYIFEEDPSVLYFSWHRYEHQEFWPSLKESDYDAVGLGR
GEGFNINLPWNKVGMGNSDYLAAFFHVLLPMAFEFDPELVLVSSGYDSGIGDPEGQMNAT
PEVFGHLTHFLMQLANGKLCVVLEGGYHLKSLSESVCMTVKTLLGDPVPQITGEMAPCLS
AIESIQNVRAAHKPYWRWLMYEDTSVLQNLSTKSHPLKNAHPNPLTDPGSKMTNDDESVK
VERFLELHMKNILFPVPPIKTATTADSKGSAHLLPVPVHLVKEMDKTEIKALVSGFYADL
VKEDKILHSLGNMLAVLDKILKKEVCSGIAESPTAAVSVAVALRRSVQFGFQRVLCIFVG
DMQIIPNTEDGKILMIHICENEQSGKTSSKHCISLNWKEDAEGNDFFSALLGFILPVAYS
YQPNLTVIAIGPNRSLGIRGISLLFALLQGLAESRIFAVME
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgtttactttttgcctcaaatatgagtgttgggatatttgttttgtcctgtgtgtagca
atggcctcaggaacagctctggtttatgatgaggagatgaccactcataaactgctttgg
agcgatcctgtttgcgatatcgaagtgccagaaaggctgtcatcctcctatgagcagctt
aaatgttaccatcttgtggaaagatgtgtccatgtgcctgccagagaaggaagcgaggag
gagatcctgttggttcacagttctgaacacttggaaatggcaaaaagcacccaaacaatg
aatgaaaaggaactgaaaagagtctctggaaattatgatgcttttttctttcatccgaac
acttatcgctgtgccaggctagcagtaggagcaactttgcagctcgtggatgctgtgatg
acaggaaaagtgtgcaatggaatggcattagtaagacctccaggtcaccacagccagaaa
aatgcagctaatgggttctgtttgttcaacaatgttgctattgcagcagaatatgcaaaa
ctgaaatatggtctacagagaatcctaattgttgactgggatgtgcaccatgggcaagga
actcaatatatattcgaagaggatccaagtgttttgtatttttcctggcatcgctatgaa
catcaggaattctggccatcactcaaagaatctgattatgatgctgtgggtctgggcaga
ggagaaggttttaacataaatttgccttggaataaggttgggatgggaaattcagattat
cttgctgcatttttccatgtgttgcttccaatggcttttgagtttgatcctgaattggtt
cttgtctcctctggttacgattctggaattggagaccctgaaggtcagatgaatgcaact
cctgaggtttttggccaccttacccatttcctgatgcagttagctaatggaaagctgtgt
gttgtcctagagggtggataccacttaaagtcattgtctgaatcagtctgtatgactgta
aaaactttgcttggagatcctgtacctcaaataactggagaaatggcaccttgcctaagt
gcaattgagtctattcaaaatgtgagagcagcacataaaccctactggagatggttgatg
tatgaagacacatcagttttacaaaatttgagcaccaagtcacacccactaaagaacgct
catccgaatcccctcacagaccctggatctaagatgactaacgatgatgaaagtgtcaaa
gtagaaaggtttttggaactgcacatgaaaaatattctatttccagtacctcccatcaaa
acagcaacaacagctgactctaaaggttcagcacatttgctccctgtacccgttcatttg
gtgaaggaaatggataaaacggaaataaaagcgcttgtcagtggcttttatgcagacctt
gtgaaagaggacaaaattttacactctcttggcaatatgctggctgtcctagataaaata
cttaagaaggaggtatgcagtggaattgcagaatcacccacagctgctgtttctgttgct
gttgcactaagacgttctgttcagtttggatttcaaagggtgctttgtatatttgttgga
gacatgcaaatcataccgaacacagaagatggaaaaatactcatgatacatatttgtgag
aatgaacagtctggaaagaccagctccaaacactgtatttctctaaactggaaagaggat
gccgaaggaaatgatttcttttctgctctacttggattcattcttcctgtagcatatagt
tatcagcctaacctgacagtaatagctattggaccaaacaggagccttggaatacgtggg
atttctctgctttttgctttactacaaggattagccgagtctcgcatttttgcagtgatg
gagtga

DBGET integrated database retrieval system