KEGG   Columba livia (rock pigeon): 102090751
Entry
102090751         CDS       T02912                                 

Gene name
CHEK2
Definition
(RefSeq) serine/threonine-protein kinase Chk2 isoform X1
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04110  Cell cycle
clv04115  p53 signaling pathway
clv04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102090751 (CHEK2)
   04115 p53 signaling pathway
    102090751 (CHEK2)
   04218 Cellular senescence
    102090751 (CHEK2)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102090751 (CHEK2)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   102090751 (CHEK2)
DNA repair and recombination proteins [BR:clv03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    102090751 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like YrbL-PhoP_reg Pkinase_fungal Kdo RIO1 APH
Other DBs
NCBI-GeneID: 102090751
NCBI-ProteinID: XP_005498241
UniProt: A0A2I0M8D5
LinkDB
Position
Unknown
AA seq 522 aa
MSRETGSEAQQSQGAQQSQGGTSSSSSGSQSTSQSSSSSGTLSSLDTVPTQELPSIPEDQ
EPEELAPQPWGRLFALGKGFSNCDCVNDEYWFGRDKSCDYSFSKLGLSDTGFYQNYSKKH
FRIFREMGPKNSHVAYIEDHSANGTFVNRELVGKGRRLPLTHNSEIALSIQNNKVFVFSD
LMVDDQLVFPREFREKYIMSKTLGSGACGEVKLAFEKSTCNKVAVKIINKRKFMASGIRE
ANPAFNINTEIEILKKIDHPCLIKIKNFYEAEDYYIVLELMEGGELYDRVSRPVKMKEAT
CKLYFYQMLLAVKYLHDNGIIHRDLKPENVLLSSSEETCLIKITDFGQSKILGETSLMKT
LCGTPTYLAPEVLNSLGTAGYSRAVDCWSLGVILFVCLCGYPPFNEQNTQLSLKDQITRG
EYTFIPKEWKHVSDMALDLVKKLLVVDPSKRLTTEEALEHPWLQDEDMKSTFQQLLAQTS
ATMNPPQTSKMPTTMRKRLHEAEGDSGSSKRAVPSTSFQKMK
NT seq 1569 nt   +upstreamnt  +downstreamnt
atgtcccgagagactggaagcgaagcccagcagtcccaaggcgcccagcagtcccagggc
ggcaccagctcctcctccagcggctcccagagcaccagtcagtcctcctccagctccggg
accctcagttccctggacactgttcccacgcaggagctgccgtcgatccctgaggaccag
gaacccgaagagctcgctcctcagccttggggtcgactctttgcacttggaaaaggtttc
agcaattgtgactgtgtgaatgacgaatactggtttggcagagacaaaagctgtgattat
agtttttctaagctgggattgtctgatactggcttctaccaaaactatagcaagaagcat
ttccgaattttcagggaaatgggtccaaaaaattcccatgttgcctacattgaagaccac
agtgcaaatggaacttttgttaacagagagcttgttggaaaagggaggaggcttccactg
actcacaactctgaaattgcattgtctatacagaataataaggtgtttgtattttctgat
cttatggtggatgatcagttggtgtttcctagagaattcagagagaaatatatcatgtcc
aagactttgggaagcggggcctgcggagaagtcaaactggcgtttgagaagagcacttgt
aataaagtcgcggtgaagataatcaataaacggaagttcatggccagcggcattagagag
gcgaacccggcttttaatatcaatacagaaattgaaattttgaagaaaatagatcatcct
tgcttaatcaagatcaaaaacttctatgaagcagaggattactacattgttttggaactg
atggaaggaggagaattgtatgacagagtgtcaaggccagtcaagatgaaagaagctact
tgcaagttgtatttttatcagatgctgctggctgtgaagtatcttcatgacaatggaatt
atacaccgagatctaaagccagagaatgtgctactttcatcttctgaagagacatgtctt
ataaagattacagattttggacagtccaagattcttggagaaacttctctcatgaaaaca
ttatgtggtactcccacgtatcttgctcctgaggttctaaattcacttgggactgctgga
tacagccgagctgtggactgctggagtttaggagttattctttttgtgtgcttgtgtgga
tatccaccatttaatgagcaaaatacccagctgtcactgaaagatcagatcactcgtgga
gaatacacgttcattcccaaagaatggaagcacgtatcggacatggctctggatctcgtg
aagaagctgttagtagtggatccaagcaaacgtcttacgacagaggaagccctggagcat
ccgtggcttcaggatgaggatatgaagagtacatttcaacagctactggctcagacaagt
gctactatgaatccaccacaaacatcaaaaatgccaaccacaatgagaaagcgtctccat
gaagccgagggagactcgggctcttcgaagcgtgctgttccttctacgtcatttcagaaa
atgaagtga

DBGET integrated database retrieval system