KEGG   Columba livia (rock pigeon): 102090839Help
Entry
102090839         CDS       T02912                                 

Definition
(RefSeq) lysosomal alpha-glucosidase isoform X2
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00052  Galactose metabolism
clv00500  Starch and sucrose metabolism
clv01100  Metabolic pathways
clv04142  Lysosome
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102090839
   00500 Starch and sucrose metabolism
    102090839
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102090839
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:clv04147]
    102090839
Enzymes [BR:clv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102090839
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102090839
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102090839
NCBI-ProteinID: XP_005504581
UniProt: A0A2I0M0W8
LinkDB All DBs
Position
Unknown
AA seq 928 aa AA seqDB search
MKSYQKLTTAVPQPASCQLEEEGSAPAPAGRGKLAPCWVGSGLLVAAVLLSAVTVWVLRQ
VSRGWPGPALPPKCLLVPESYRFDCYPERHVVVTQELCESRGCCFIESPPPAGGKRGVPW
CFYPPDFPSYTLESLNQTALGMVGLLVRREKAYYPQDIKTLRLDVEFETDTRLHIKITDA
ASPRYEVPLEVSRAMKRAENPIYSLDFSRDPFGLLLRRRATGTVLLNTTVAPLIFADQFL
QIATSLPSRFLYGLGEHRGSLLHSLDWNTLTLWARDVPPTESFNLYGAHPFYLLMEEGGD
AHGVFLLNSNAMEVALQPAPGLTWRTIGGVLDFYIFLGPDPNMVIQQYQQVIGFPAMPPL
WALGFHLCRWGYGSSNETWQTVRAMRNYQIPQDAQWNDIDYMDGYRDFTFDPQNFASLPS
LVEDLHKHGQHYVMILDPGISRTSPNGSYWPFDEALRRGLFLNTTKGQPLIGQVWPGLTA
FADFSNPDTHQWWLENLQRFHAHVPFDGLWIDMNEPSNFMDGSEEGCPPGELDSPPYTPA
VLGDSLSAKTVCASAKQKASVHYNLHNLYGLMEAKATASALIQIRGKRPLVISRSTFPSQ
GRYSGHWLGDNRSQWKDMYYSIPGLLSFSLFGIPLVGADICGFSGSTSEELCTRWMQLGA
FYPFARNHNTQNEKAQDPTVFSPAARTAMKDVLLIRYSLLPFLYTLFHRAHLQGDTVARP
LFFEFPRDVATLGLDRQFLWGRSLLVTPVLEPEVDSVTGYLPRGVWYDFYTGSSVNSSGE
MLKMSAPLEHLNLHVREGAILPTQKPGTTSKATQGNPLRLIVALSSSDTAWGDLFWDDGE
SLDTFERGSYSYLVFNVTQNIFTSTILHASTEVTEVTIDTLSIFGVREPPSKVLLNGQEK
PFSYLDNQVLTVSDLGLSLSQGFSLRWL
NT seq 2787 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcgtaccagaagctgaccacggcggtgccgcagccagcgtcgtgccagctggag
gaggaagggtctgccccagcgcccgccggccgcgggaagctggccccgtgctgggtgggc
agtgggctgctggtggccgctgtgctgctgagcgccgtcaccgtctgggtgctgcggcaa
gtatcgaggggctggcctggacctgcgctgccccccaaatgtctgctggtacccgaaagc
taccgctttgactgctacccagagcggcatgtggtggtgacccaggagctctgtgaaagt
cggggatgctgcttcatcgagagccccccacccgcagggggcaagcggggggtgccctgg
tgcttctacccccctgatttccccagttacaccctggagagcctcaaccagacggcgctg
ggcatggtggggctgctggtgcggagggagaaggcctattacccacaggacatcaaaacg
ctgaggctggacgtggagtttgagacagacacacggctccacatcaagataacagatgca
gccagcccacggtacgaggttccccttgaggtttcccgggcaatgaagagagcagaaaac
cccatctacagcctggacttctcccgggacccctttgggctgctgctgcggcgcagggcg
acagggacggtgctgctcaacaccactgtggcccccttgatcttcgctgaccagtttctc
caaatagccacatcgctcccatccaggttcctgtacgggctgggggagcaccgcggcagc
ctcctgcacagcctggactggaacaccctcaccctgtgggcacgcgacgtccctcccacg
gaatcgttcaacctctacggcgctcaccccttctacctgctgatggaggagggtggagat
gctcacggcgttttcctcctcaacagcaatgcgatggaggtggccctgcagcccgctcca
ggcctgacctggaggaccatcgggggggtgctggatttttacatcttcctggggcccgac
cccaacatggtcatccagcagtaccagcaggtgataggtttcccagccatgccgcccctc
tgggcgctcggcttccacctctgccgctggggctacggatccagcaacgagacctggcag
accgtgagagccatgaggaactaccagatcccccaggatgcgcagtggaatgacatcgat
tacatggacgggtaccgggacttcaccttcgatccccagaactttgcctctctcccgtca
ctggtggaagacctccacaaacacgggcagcactacgttatgatcttggatcctggaatc
agcagaaccagccctaacggctcctactggccttttgatgaagccttgagacggggcttg
ttcctcaacaccaccaaagggcagccactcatcgggcaggtctggcctggcttgacagcc
ttcgcagacttctccaacccagacacacaccagtggtggctggagaacctgcagcggttc
catgcccatgtgcctttcgatggcctctggatcgacatgaatgagccatccaacttcatg
gatgggtctgaagaaggctgcccgcccggagagcttgacagtcccccatacaccccggcc
gtgctgggcgattccctctctgcaaagacggtgtgtgcctcggccaagcagaaagcctca
gtgcactacaacctccacaacctctatgggctgatggaagccaaagccacagcgagcgca
ctgatccagatccgggggaagcgcccgctcgtcatctcccgctccaccttccccagccag
ggccggtactcggggcactggctgggcgacaaccggagccagtggaaggacatgtattac
tccatcccagggctgctgagcttcagcctcttcggcatcccgctggtcggcgcggacatc
tgcggcttctcaggcagcacctcggaggagctgtgcacccgctggatgcagctcggcgcc
ttctaccccttcgcccgtaaccacaacacccagaacgagaaggcccaggacccgacggtg
ttcagccccgcggcaaggacggccatgaaggacgtgctgctgatccgctactccctcctg
cccttcctctacaccctgtttcaccgtgcccacctgcaaggggacactgtggcccggcct
ttgttctttgagttcccccgggatgtggccaccttggggctggacaggcagtttctgtgg
ggcaggagcttgctggtgacaccagtgctggagcccgaggtagactcggtcacaggctac
ctccctcgaggcgtgtggtacgacttctacacgggctcctcagtgaacagcagtggggag
atgctgaagatgtcagctcccctggagcacctcaacctgcatgtgcgggagggtgccatc
ctgcccacacagaaaccagggaccaccagcaaggcgactcaggggaaccctctgcgcctc
attgtggccttgtcctcaagtgacaccgcctggggggacctcttctgggatgatggtgag
agcctggacacctttgagcgaggcagctactcctacctggtgttcaatgtcacacagaac
atcttcacctccaccatcctccatgccagcactgaggtcactgaggtcaccattgacacg
ctgagcatctttggggtgcgggaaccacccagcaaggtccttctgaatgggcaggagaag
cccttctcctacctggacaaccaggttctcactgtgagtgaccttggtctcagcctcagc
cagggcttctccctgcgctggctgtga

DBGET integrated database retrieval system