KEGG   Columba livia (rock pigeon): 102091153
Entry
102091153         CDS       T02912                                 

Gene name
FGF1
Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102091153 (FGF1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102091153 (FGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:clv04052]
    102091153 (FGF1)
   00536 Glycosaminoglycan binding proteins [BR:clv00536]
    102091153 (FGF1)
Cytokines and growth factors [BR:clv04052]
 Growth factors
  Growth factors (RTK binding)
   102091153 (FGF1)
Glycosaminoglycan binding proteins [BR:clv00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   102091153 (FGF1)
SSDB
Motif
Pfam: FGF Fascin MMS1_N
Other DBs
NCBI-GeneID: 102091153
NCBI-ProteinID: XP_005512500
UniProt: A0A2I0LTA7
LinkDB
Position
Unknown
AA seq 155 aa
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGKVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTQSGQYLAMDPTGLLYGSQLLGEECLFLERIEENHYNTYVSKKHADK
NWFVGLKKNGNSKLGPRTHYGQKAILFLPLPVSAD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggccgagggggagatcaccaccttcaccgccctgaccgagaagttcaacctgcccccc
gggaactacaagaaacccaaactcctgtactgcagcaacggtggccacttcctacgcatc
ctcccggacgggaaagtggatgggaccagggaccgaagcgaccagcacattcagctccag
ctcagcgcggaaagcgtgggagaggtgtacataaagagcacccagtccgggcagtacctg
gcgatggaccccaccgggctgctctacggctcgcagctgctgggcgaggagtgcctgttc
cttgagaggatcgaggagaaccattacaacacgtacgtctccaaaaagcacgcggataag
aactggtttgtgggcctgaagaagaacgggaacagcaagctggggccgcggacacactac
ggccagaaggccatcctcttcctcccgctgcccgtctcagccgactaa

DBGET integrated database retrieval system