KEGG   Columba livia (rock pigeon): 102091154
Entry
102091154         CDS       T02912                                 

Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04080  Neuroactive ligand-receptor interaction
clv04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102091154
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102091154
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:clv04030]
    102091154
G protein-coupled receptors [BR:clv04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    102091154
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 102091154
NCBI-ProteinID: XP_021157046
LinkDB
Position
Unknown
AA seq 426 aa
MLGCGGCVSRTAAMKHCFYNETVGFFYNNSRKELTTYWRTKDVLVVALGLTVSVIVLLTN
LLVITAIIINRRFHYPIYYLLGNLAAADLFAGIAYMFLMFHTGPRTAELSLKTWFIRQSL
LDTSLTASVVNLLAIAVERHQTVFTMQLHSKMSNQRVMILIFCIWVTALLLGLIPSYGWH
CLCALDKCSSMAPLYSRSYLTFWAISNLVIFLIMVVVYTHIFIYVKRKMTRMSKHTSFHS
DYKETMISLVKTVTIILSAFVICWTPGQVVLLLDGLGCKSCNVLAVEKYVLLLAEINSLI
NAIVYSYRDSEMRSTFRRILCFVCYRNSKYTPTVVKLNTADRRTLSQNGHFTVDSSKAQA
RAEVFPAILVSGKGQERTREASLSPKTPKLRQRTEKEGKARPKAFKDGVLFRTNTLSSIH
IKDSCF
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgctcggatgcggtggttgtgtttccaggacagcagcgatgaagcactgtttctacaat
gagaccgtgggcttcttctacaacaacagccgcaaagagttgacaacgtactggaggacc
aaggacgtgctggtggtggccctgggcctgacggtgagcgtcattgtgctcctcaccaac
ctgctggtcatcaccgccatcatcatcaaccggcgcttccactaccccatctactacctg
ctggggaacctggcggccgccgatctcttcgccggcatcgcctacatgttcctcatgttc
cacacggggccccggaccgcggagctctccctcaagacctggttcatccggcagagcctg
ctggacaccagcctgacggcctccgtggtgaacctgctggccatcgccgtcgagaggcac
cagactgtgttcaccatgcagttgcacagcaagatgtccaaccagcgcgtgatgatcctc
atcttctgcatctgggtcacggctctgctcctggggctcatcccctcctatggctggcac
tgtctctgcgccctggacaagtgctccagcatggccccgctctacagcaggagctacctg
accttctgggccatctccaacctcgtcatcttcctcatcatggtggttgtgtacacgcac
atcttcatctacgtcaagaggaagatgacgcgcatgtccaagcacaccagcttccactct
gactacaaggagaccatgatcagccttgtcaagacggtcactatcatcctaagtgctttt
gtcatctgctggaccccaggccaagtcgtgctcctcctggacggcctgggctgcaagagc
tgcaacgtcctggccgtggagaaatacgtcctgttgctggcggagatcaactcgctcatc
aacgccatcgtctactcgtacagggacagcgagatgcgcagcaccttccggaggatcctc
tgcttcgtgtgctacaggaattccaaatacacccccacggtggtgaagctgaacaccgcg
gaccgcaggacactttcgcagaacggccacttcactgtggattcctccaaagcacaggct
cgagcagaagtatttccagcgatacttgtcagcgggaaaggacaagagaggacaagagag
gcttcgctcagccccaaaactccaaagctgaggcagagaacggaaaaggaaggaaaagcc
aggcctaaagcttttaaggacggggtgttgtttaggacgaacacactgagtagtattcat
attaaagacagctgtttctaa

DBGET integrated database retrieval system