KEGG   Columba livia (rock pigeon): 102091331Help
Entry
102091331         CDS       T02912                                 

Gene name
GALNT17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00512  Mucin type O-glycan biosynthesis
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102091331 (GALNT17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:clv01003]
    102091331 (GALNT17)
Enzymes [BR:clv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102091331 (GALNT17)
Glycosyltransferases [BR:clv01003]
 O-Glycan biosynthesis
  Mucin-type
   102091331 (GALNT17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 RicinB_lectin_2
Motif
Other DBs
NCBI-GeneID: 102091331
NCBI-ProteinID: XP_005511660
UniProt: R7VTU8
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPITAKSGDSFHDIHPRAEVANLTARGISSIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPEEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYGKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
AHLLKEIILVDDNSDEEELKAPLEEYVNKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
ITGFFDAHVEFTAGWAEPVLSRIQENRRRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVHRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNNNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPQENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNVKSRFPQLLD
CEKVKSSLHKRWNFIQNGAILNKGTGRCLEVENRGMAGIDLILRSCTGQRWTIKNFIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttgaggagagtcaaagtcctgctggtgttaaacttgatcgcggtggctggc
ttcgttctcttcctggccaagtgcagacccatcacggccaagagcggcgactccttccat
gacatccatcccagggcagaagtggccaacttgacagcccgtggcatcagctccatccag
gatgcggtgctgaaaaggctctcccttctcgaagatatagtctacaggcagctgaatggt
ctgtccaagtcgctgggtctcattgagggctatggtggccgcggtaaaggtggtcttccc
gccaccctgtcccctgaggaggaggagaaggcaaagggaccccatgagaaatacggctac
aactcctacctcagcgagaaaatttccctggatcgttccatcccagattatcgcccaacc
aagtgcaaagagctgaaatacggcaaggacctgccccagatctccatcatcttcatcttc
gtgaacgaggcgctgtcggttatcctgcgatcagtgcacagcgccgtgaatcacacacca
gctcacctcctgaaggagatcatccttgtggatgacaacagtgatgaagaggagctgaag
gcgccactggaagaatacgtcaataagcgctaccccgggctggtgaaggtggtgcgcaac
cagaagagagagggactcatccgcgctcggatcgagggctggaaagctgccactggccag
atcacggggttttttgatgctcacgtggagttcactgccggctgggctgagcccgtcctc
tcacggattcaggagaaccggaggagggtcattctcccctccatagacaacatcaagcag
gacaacttcgaggtgcagcgttacgagaactcggcgcacgggtacagctgggagctgtgg
tgcatgtacatcagcccccccaaggactggtgggacgccggggacccctcgctgcccatc
aggacgccggcaatgatcggttgctcgttcgttgtgcacagaaagttcttcggagaaatt
gggcttctcgatcccgggatggacgtgtacggaggggagaacatagagctcggcatcaag
gtgtggctgtgcggtggcagcatggaggtcctgccctgctcccgggtggctcacatcgag
cgcaagaagaagccctacaacaacaacatcgggttctacaccaagcgcaatgccctgcgg
gtggccgaggtgtggatggacgactacaaatcccacgtctacattgcgtggaacctgccg
ctagagaatccaggtattgacatcggggatgtttccgagagaaaagcgttaaggaagagc
ttgaagtgtaaaaatttccagtggtatctggaccacgtttatccggaaatgagaagatac
aacaacacagtcgcttatggcgagcttcgaaacaacaaggcgaaagatgtgtgcctggac
cagggcccgcaggagaaccacacagcaatattgtacccgtgtcatggctggggacctcag
cttgcgcgctacaccaaggagggattccttcatctcggcgccctcggcaccacgactctt
ctccctgatacccgctgcctggtggataacgtgaaaagccgcttccctcagctccttgat
tgcgaaaaggtcaagagcagcctccataagcgctggaatttcatacagaatggtgccatc
ctgaacaagggaacgggacgatgcttggaagtggagaacagaggaatggctggcatcgat
ctgattcttcgcagctgcacaggacaaaggtggacgattaagaatttcatcaagtaa

DBGET integrated database retrieval system