KEGG   Columba livia (rock pigeon): 102091343
Entry
102091343         CDS       T02912                                 

Gene name
CCNE1
Definition
(RefSeq) G1/S-specific cyclin-E1
  KO
K06626  G1/S-specific cyclin-E1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04110  Cell cycle
clv04114  Oocyte meiosis
clv04115  p53 signaling pathway
clv04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102091343 (CCNE1)
   04114 Oocyte meiosis
    102091343 (CCNE1)
   04115 p53 signaling pathway
    102091343 (CCNE1)
   04218 Cellular senescence
    102091343 (CCNE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:clv03032]
    102091343 (CCNE1)
   03036 Chromosome and associated proteins [BR:clv03036]
    102091343 (CCNE1)
DNA replication proteins [BR:clv03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102091343 (CCNE1)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102091343 (CCNE1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102091343
NCBI-ProteinID: XP_005514473
UniProt: A0A2I0M7Y1
LinkDB
Position
Unknown
AA seq 407 aa
MRRESDCAEEKAPAGGDGCAEGAMRARKRKADVATFLQDPDEEIAQMEMTRKKQYENQPS
WNNVHKNAHMLLPTPDKDDDPVGVDYSPFIHLSVVQTRASPLPVLGWANRDDVWKNMMKK
EETYVRDKLYMQRHPLLQPKMRTILLDWLMEVCEVYKLHRETFYLAQDFFDRFMATQQNV
VKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACTEDEILSMELIIMKALNWNLNP
LTVVSWLNIYMQVAYLNELYEVLLPQYPQQIFVQIAELLDLCVLDIGCLEYTYGVLAASA
LYHFSSSELIQKVSGYEWWEIEECVKWMVPFAMAIREVGSSKLKHFRGIAPEDLHNIQTH
VNCLDLLDKAQAKQAILAEQNRTSPFPTGVLTPPQSSKKQCSGPKPI
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgcgccgggagagcgactgcgcggaggagaaggctcccgccgggggggacgggtgtgcg
gagggcgccatgcgagcccgcaagaggaaagccgatgtggccacgttcttacaggatccg
gatgaagagattgcccaaatggagatgactagaaaaaagcagtatgaaaaccagccatcc
tggaataacgttcacaaaaatgcccatatgctgcttcctactccagataaagatgatgat
ccagttggtgttgattactctccctttatacatctgagtgttgttcaaactagagcttca
ccattaccagttctaggctgggcaaacagagatgacgtatggaaaaacatgatgaaaaaa
gaagagacgtatgtgagggataaactttatatgcaaaggcaccctctcctgcaacctaag
atgagaacaatccttctagactggctaatggaggtttgtgaagtctacaagcttcataga
gaaactttttatttagcacaagatttctttgatcggttcatggcgacacaacagaatgtt
gtaaaaacactattgcagcttattggtatctcttctttattcatagcagcaaaacttgag
gaaatttatccaccgaagctgcaccaatttgcctatgttacagatggagcttgtacggaa
gatgaaatcctcagtatggaattgatcattatgaaggctcttaattggaacttaaatcca
ctgacagttgtatcatggctaaacatttacatgcaagttgcatatttaaatgagctttat
gaggtattgctgccacaatatccacagcaaatatttgtacaaatagcagagctcttggat
ctctgtgtgctggatattggctgcttggaatatacatatggagtacttgcagcttctgcg
ttgtatcacttctcctcatccgagttgatacagaaagtttcaggttatgaatggtgggag
atagaggagtgtgtaaagtggatggttccgtttgcgatggctataagggaagtaggaagc
tccaaacttaaacactttagaggtatagctcctgaagacttgcacaatatacagacgcac
gtaaactgcttggatttgctggacaaagctcaagcaaaacaagccatattggctgagcaa
aataggacttcacctttccccactggtgtccttacaccaccacagagcagtaagaaacag
tgttctggaccgaagccaatatga

KEGG   Columba livia (rock pigeon): 102094830
Entry
102094830         CDS       T02912                                 

Gene name
CCNE2
Definition
(RefSeq) G1/S-specific cyclin-E2 isoform X1
  KO
K06626  G1/S-specific cyclin-E1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04110  Cell cycle
clv04114  Oocyte meiosis
clv04115  p53 signaling pathway
clv04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102094830 (CCNE2)
   04114 Oocyte meiosis
    102094830 (CCNE2)
   04115 p53 signaling pathway
    102094830 (CCNE2)
   04218 Cellular senescence
    102094830 (CCNE2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:clv03032]
    102094830 (CCNE2)
   03036 Chromosome and associated proteins [BR:clv03036]
    102094830 (CCNE2)
DNA replication proteins [BR:clv03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   CDK (cyclin dependent kinase)
    102094830 (CCNE2)
Chromosome and associated proteins [BR:clv03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    102094830 (CCNE2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 102094830
NCBI-ProteinID: XP_005499491
LinkDB
Position
Unknown
AA seq 405 aa
MSRRSSRLQAKQQQPLSCQEESPQELQAPEHLQSRKKRTAEQEIKKKEDGKIAKKHQYEI
KSCWPPTITGGISPCIIIETPHKESVTTDFSRFKKYRFRNLFINPSPLPELNWGNSKDVW
LNILKKENRYAHCKHFTSLHSSLQPHMRSILLDWLLEVCEVYALHRETFYLAQDFFDRFM
LTQKNINKSMLQLIGITSLFIASKLEEIYAPKIQEFAYVTDGACSEDDIVRMELIMLKAL
KWELCPVTIISWLNLYLQVDALKDVPKVLLPQYSQEKFIQIAQLLDLCILDVNSLDFQYR
TLAAAALCHYTSIEVVKKVSGLDWDSISECVEWMVPFANVAKKVPVKLKNFKKVAVEDRH
NIQTHTNYLDMLEEVNSGAASTAPGQLSPVSTGGIITPPKSTEKK
NT seq 1218 nt   +upstreamnt  +downstreamnt
atgtcaagacgcagtagccgattgcaagccaagcagcagcagccactgtcatgtcaagaa
gagtctccacaagaactgcaggcaccagaacatcttcagagcagaaaaaagagaacagca
gagcaggagattaagaaaaaagaagatgggaaaattgcaaaaaagcatcaatatgagatt
aagagttgttggccgcccacgataacaggaggcatctcgccttgtataattattgagaca
cctcacaaagaatcagtaaccactgacttttcaagattcaaaaaatacaggttcagaaac
ctcttcataaatccatcacctttgccagaactcaactggggaaactccaaagatgtctgg
ctcaatatcctgaagaaggagaacagatatgctcattgcaaacatttcacatcactacat
tccagtttgcagcctcacatgagatcgatactgttagactggctcttagaggtgtgtgag
gtgtatgcactccacagggaaaccttctacctagctcaagacttttttgatagattcatg
ttgacacaaaagaacattaacaagagcatgcttcagctcataggaattacctcattattc
attgcctccaaacttgaggaaatctacgctcctaaaatacaggaatttgcttacgtcact
gatggtgcttgcagtgaagatgatattgtaagaatggaactcattatgttaaaggcttta
aaatgggaactctgtccagtgacaatcatctcttggctgaacctgtatcttcaagtggat
gcgctaaaggatgttccaaaagtgctgctacctcagtattctcaggaaaaattcatccag
atagcacagctcttagacctgtgtattctggatgtgaattctttggacttccagtacaga
acactagctgctgcagcgctctgccactatacctcaattgaagtagttaagaaagtttca
ggcttagattgggacagcatttcagagtgtgtagaatggatggttccctttgcaaacgtg
gccaaaaaagtccctgtgaagctgaagaactttaagaaggttgcagtagaagatcgacat
aacatccaaacacacacaaactacttggacatgctggaagaagttaacagtggagcagca
tctactgccccaggtcagttatcacctgtttcaacaggaggaataataacccctcccaaa
agtacagagaagaagtga

DBGET integrated database retrieval system