KEGG   Columba livia (rock pigeon): 102091387
Entry
102091387         CDS       T02912                                 

Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00480  Glutathione metabolism
clv00980  Metabolism of xenobiotics by cytochrome P450
clv00982  Drug metabolism - cytochrome P450
clv00983  Drug metabolism - other enzymes
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102091387
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102091387
   00982 Drug metabolism - cytochrome P450
    102091387
   00983 Drug metabolism - other enzymes
    102091387
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:clv02000]
    102091387
Enzymes [BR:clv01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102091387
Transporters [BR:clv02000]
 Other transporters
  Pores ion channels [TC:1]
   102091387
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_N_4 Glutaredoxin2_C GST_C_5 Lact-deh-memb
Other DBs
NCBI-GeneID: 102091387
NCBI-ProteinID: XP_005508604
UniProt: A0A2I0MEG6
LinkDB
Position
Unknown
AA seq 242 aa
MSGDHSRSLAKGSAAPGPVPEGLIRLYSMRFCPFAQRARLVLRAKGISHEVININLKNKP
DWFFEKNPFGLVPVLETSKGQLIYESPITCEYLDEAFPGKKLMPSDPYERALQKMLLEHF
SKLTSIVFKHVMAVKEGQDTTALKAEIAEKLDKFEEILSKRNTVFYGGDSISMLDYMMWP
WFERLEALQLKDSLSHTPKLQHWMEAMKEDPAVKATMTDPQIYKDYLQLYLKNSPEACDY
GL
NT seq 729 nt   +upstreamnt  +downstreamnt
atgtcgggcgaccactctcgcagcttggccaagggcagcgcggcccctgggcccgtgccc
gagggcctgatccggctgtacagcatgcggttctgccctttcgcccagcgggcgcgtctt
gtcctccgcgccaagggcatcagccatgaagtaattaacatcaatctgaagaacaaacct
gactggttctttgagaagaacccctttgggctggttcctgttctggagaccagcaagggc
cagctgatctacgagtccccaatcacttgcgaatatttggatgaagcatttccagggaag
aagttgatgccttcagacccatatgagcgagcccttcagaagatgctcttggaacacttc
tcaaagttaacatccatagttttcaagcatgttatggcagtcaaagaagggcaggacacc
accgcactcaaagcagagattgctgaaaagcttgacaaatttgaagagattctgtccaaa
cgcaacactgtgttttatggtggggactcaatctccatgcttgactacatgatgtggccg
tggtttgaacgtctggaagcattgcagctgaaggactctttgagtcacaccccaaagctc
caacactggatggaggccatgaaggaggaccctgctgtcaaggctacaatgactgacccc
cagatatacaaagattacctccagctctatttgaagaacagccctgaggcatgtgattat
gggctctga

DBGET integrated database retrieval system