KEGG   Columba livia (rock pigeon): 102091436Help
Entry
102091436         CDS       T02912                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00010  Glycolysis / Gluconeogenesis
clv00053  Ascorbate and aldarate metabolism
clv00071  Fatty acid degradation
clv00260  Glycine, serine and threonine metabolism
clv00280  Valine, leucine and isoleucine degradation
clv00310  Lysine degradation
clv00330  Arginine and proline metabolism
clv00340  Histidine metabolism
clv00380  Tryptophan metabolism
clv00410  beta-Alanine metabolism
clv00561  Glycerolipid metabolism
clv00620  Pyruvate metabolism
clv01100  Metabolic pathways
Module
clv_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
clv_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:clv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102091436 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    102091436 (ALDH7A1)
   00620 Pyruvate metabolism
    102091436 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102091436 (ALDH7A1)
   00561 Glycerolipid metabolism
    102091436 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    102091436 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    102091436 (ALDH7A1)
   00310 Lysine degradation
    102091436 (ALDH7A1)
   00330 Arginine and proline metabolism
    102091436 (ALDH7A1)
   00340 Histidine metabolism
    102091436 (ALDH7A1)
   00380 Tryptophan metabolism
    102091436 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102091436 (ALDH7A1)
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102091436 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     102091436 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     102091436 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 102091436
NCBI-ProteinID: XP_005506754
UniProt: A0A2I0LS68
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MFESEDTEAKRVICVIKLHLHSRRTILTTLLVSQPRYAWLRELGLQEENPGVYNGRWGGG
GQVVTTFCPANNQPIASVRQANLEDYEETVKAAKEAWKVWADIPAPKRGEIVRQIGDALR
QKIKVLGSLVSLEMGKIFVEGVGEVQEYVDVCDYALGLSRMIGGPVLPSERPGHALIEQW
NPLGLVGIITAFNFPVAVYGWNSAIAMICGNACIWKGAPTTSLISVAVTKIISRVLEDNK
VPGAICSLVCGGADIGTAMARDERIDLLSFTGSTKVGKQVALMVQERFGRSLLELGGNNA
IIVFEDADLNLVIPSALFAAVGTAGQRCTTVRRLFLHESIHDEVVAKLAKAYAQVRIGDP
WDSDTLYGPLHTKEAVKMFLDTVEQAKQQGGSVVCGGKVINRPGNYVEPTIVTGLPHDAP
VVHTETFAPILYVLKFKEQEEVFAWNNEVKQGLSSSIFTKDLGRIFCWLGPKGSDCGIVN
VNIPTSGAEIGGAFGGEKHTGGGRESGSDSWKLYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatcagaagatacggaagcaaaacgtgtaatctgtgtaatcaagctgcacctt
cacagtagaagaacaatattgaccaccctgctggtcagccagccgcgctacgcctggctg
cgggagctgggcctgcaggaggagaacccgggagtgtacaacgggcgctggggcggcggc
ggccaggtggtgacgacgttctgccccgccaacaaccagcccatcgccagcgtccgacag
gctaatttggaggattatgaagaaacagtaaaggcggctaaagaggcatggaaggtctgg
gctgatatccctgcacctaagcgtggagaaatagtgcggcagattggtgatgccctgaga
caaaagatcaaagttttgggaagtttggtctctttggaaatggggaagatttttgtggaa
ggtgttggggaagtgcaggagtatgttgatgtgtgcgactatgctcttggtttgtcccga
atgattggtggacctgtcttgccttcagaaagacctggccatgcccttatagagcagtgg
aatcccctggggttagtaggaatcatcactgcctttaacttcccggtagcagtttatgga
tggaacagcgcaattgcaatgatctgtggaaatgcttgcatctggaagggtgctcctaca
acatcactcattagtgttgctgttacaaagataatttccagagtcttggaggataacaaa
gtgcctggagcaatctgttctctggtttgtggtggagcagatattgggacagcaatggcg
agagatgagagaatcgacctgttgtctttcactggaagcacgaaagtgggcaagcaagtg
gcacttatggttcaggagagatttggtcgaagtctgctggaactgggaggaaataatgcc
attattgtgtttgaagatgcagacctgaaccttgtcatcccatctgctctgtttgctgct
gtgggaacagcaggtcagaggtgcacaactgttagaaggctgttcctccatgaaagcatc
catgacgaggtggtggcaaagcttgctaaggcgtatgcccaggtccgcattggtgatcca
tgggattctgacactctgtatgggcctcttcataccaaagaagctgtgaaaatgttcctt
gatacagtagaacaagcaaaacaacagggtggctctgtcgtctgcggtggaaaggttata
aatcgccctggaaactatgttgaaccaaccattgtgactggccttcctcatgatgcaccc
gttgtccacactgagacatttgcccccatactatatgtgctgaaatttaaggagcaagag
gaggtttttgcctggaataatgaagtaaaacaaggtctttccagcagtatctttaccaaa
gatttgggaaggattttctgctggcttgggccaaagggatctgactgtggaattgtcaat
gtcaacatcccaactagtggggctgagattggaggagcttttggtggggaaaagcacact
ggtgggggaagagaatctggaagtgattcatggaaactttatatgagacggtctacttgt
acgatcaactacagcaaggatttacctttggctcaaggaattaagtttcagtaa

DBGET integrated database retrieval system