KEGG   Columba livia (rock pigeon): 102091546
Entry
102091546         CDS       T02912                                 

Gene name
SRC
Definition
(RefSeq) LOW QUALITY PROTEIN: proto-oncogene tyrosine-protein kinase Src
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04012  ErbB signaling pathway
clv04137  Mitophagy - animal
clv04144  Endocytosis
clv04370  VEGF signaling pathway
clv04510  Focal adhesion
clv04520  Adherens junction
clv04530  Tight junction
clv04540  Gap junction
clv04625  C-type lectin receptor signaling pathway
clv04810  Regulation of actin cytoskeleton
clv04912  GnRH signaling pathway
clv05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102091546 (SRC)
   04370 VEGF signaling pathway
    102091546 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102091546 (SRC)
   04137 Mitophagy - animal
    102091546 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102091546 (SRC)
   04520 Adherens junction
    102091546 (SRC)
   04530 Tight junction
    102091546 (SRC)
   04540 Gap junction
    102091546 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102091546 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102091546 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102091546 (SRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102091546 (SRC)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102091546 (SRC)
Protein kinases [BR:clv01001]
 Non-receptor tyrosine kinases
  SRC family
   102091546 (SRC)
Membrane trafficking [BR:clv04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    102091546 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    102091546 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    102091546 (SRC)
  Macropinocytosis
   Kinases
    102091546 (SRC)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3
Other DBs
NCBI-GeneID: 102091546
NCBI-ProteinID: XP_021143574
LinkDB
Position
Unknown
AA seq 534 aa
MGSSKSKPKDASQRRRSLEPTDNTHHGGYPASQTPSKAAAPDTHRTPSRSFGTMAAESKL
FGGFNTSDTVTSPQRAGALAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGDWWL
AHSLTTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNPENPRGTFLVRESETT
KGAYCLSVSDFDNAKGLNVKHYKIRKLDNGGFYITSPPQFNSLQSQLVAYYSKHADGLCH
RLTNVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKP
GTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGKYLR
LPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTAR
QGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGY
RMPCPPECPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1605 nt   +upstreamnt  +downstreamnt
atggggagcagcaagagcaagcccaaggacgccagccagcgccggcgcagcctggagccc
accgacaacacccaccacggggggtacccagcctcgcagacacccagcaaggcggctgct
cccgacacccaccgcacccccagccgctcctttgggaccatggctgctgagtccaagctc
tttggaggcttcaacacgtccgacacagtcacctcgccgcagcgtgccggggcgctggct
ggtggcgtcaccaccttcgtggccctctatgactacgagtctcggactgaaacagacttg
tccttcaagaaaggagagcgcctacaaatcgtcaacaacacggaaggtgactggtggctg
gctcattccctcactacaggacagacgggctacatccccagtaactatgtcgcgccctca
gactccatccaggctgaagagtggtattttgggaagatcactcgccgggagtctgagcgg
ctgctgctcaaccccgaaaaccctcgagggaccttcctggtccgggagagtgagaccacg
aaaggtgcctactgcctctccgtctccgacttcgacaacgccaaagggctcaatgtgaag
cactacaagatccgcaagctggacaacggcggcttctacatcacctcccccccccagttc
aacagcctgcagagccagctggtggcctattactccaaacacgccgatggcttgtgccac
cgtctcaccaatgtctgtcccacgtccaagccccagacccaaggcctggccaaggacgcc
tgggagatcccccgggaatcgctgcggctggaggtcaagctggggcagggctgcttcgga
gaggtgtggatggggacctggaatggcaccacgcgggtggcgatcaagacgctgaagcct
ggcaccatgtccccggaggccttcctgcaggaggcccaggtcatgaagaagctccggcat
gagaagctggttcagctctacgctgtggtttcagaggagcccatttatatcgttactgag
tacatgagcaaggggagcctcctggatttcctgaagggcgagatgggcaagtacctgcgg
ctgccccagctcgtggatatggcggctcagatcgcatctggtatggcctacgtggagagg
atgaactacgtccaccgggacctccgggccgccaacatccttgtgggggagaacctggtg
tgcaaagtggctgacttcggcttggcacgcctcatcgaggacaacgagtacacggctcgg
caaggtgccaagttccccatcaagtggacagcccccgaagctgctctgtacggcaggttt
actatcaagtcggacgtctggtcctttggcatcctcttgaccgagctgaccaccaagggc
agagtgccatacccaggaatggtgaaccgggaggtgctggaccaggtggagcgggggtac
cgcatgccctgcccccccgagtgccccgagtctctgcacgacctcatgtgccagtgctgg
cggaaggacccggaggagcgacctacattcgagtacctgcaggctttcctggaggactac
ttcacctcgacagagccccagtaccagcccggcgagaacctatag

DBGET integrated database retrieval system