KEGG   Columba livia (rock pigeon): 102091580
Entry
102091580         CDS       T02912                                 

Definition
(RefSeq) interleukin-15
  KO
K05429  interleukin 2
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04060  Cytokine-cytokine receptor interaction
clv04625  C-type lectin receptor signaling pathway
clv04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102091580
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102091580
   04672 Intestinal immune network for IgA production
    102091580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:clv04052]
    102091580
   00536 Glycosaminoglycan binding proteins [BR:clv00536]
    102091580
Cytokines and growth factors [BR:clv04052]
 Cytokines
  Interleukins
   102091580
Glycosaminoglycan binding proteins [BR:clv00536]
 Heparan sulfate / Haparin
  Cytokines
   102091580
SSDB
Motif
Pfam: IL15
Other DBs
NCBI-GeneID: 102091580
NCBI-ProteinID: XP_005510722
UniProt: A0A2I0MGL8
LinkDB
Position
Unknown
AA seq 137 aa
MMCKVLIFSCISAVMLMTTAYGASLATEKDRLLKALIKDLKFLEKSKNKIHLDLYTPNEK
QECSWHTLQCYLTEMGTLENEIEDEDFHNLRNIKMNLQSLMDLTPQGTGCKICEAHDKKR
FPAFHQELNNFLISMLK
NT seq 414 nt   +upstreamnt  +downstreamnt
atgatgtgcaaagtactgatcttcagctgtatttcagctgtgatgcttatgaccaccgct
tatggagcatctctggcaacagaaaaagatcgacttcttaaagctttaataaaagattta
aaattcctggaaaaaagcaagaataagattcatcttgatctttacacaccaaatgagaaa
caggagtgcagctggcacactctacaatgttacctgacagaaatgggcaccctggaaaat
gaaattgaagatgaggactttcataatcttcgaaatatcaaaatgaatctccagagtctc
atggacctaactccccaaggaactggatgcaagatctgtgaagctcatgacaagaagagg
tttcctgcatttcaccaagaactgaacaactttctgatatctatgctaaaataa

DBGET integrated database retrieval system