KEGG   Columba livia (rock pigeon): 102091654Help
Entry
102091654         CDS       T02912                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta type isoform X1
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04140  Autophagy - animal
clv04270  Vascular smooth muscle contraction
clv04621  NOD-like receptor signaling pathway
clv04625  C-type lectin receptor signaling pathway
clv04912  GnRH signaling pathway
clv04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:clv00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102091654 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102091654 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    102091654 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102091654 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102091654 (PRKCD)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102091654 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102091654 (PRKCD)
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     102091654 (PRKCD)
Protein kinases [BR:clv01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   102091654 (PRKCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 Pkinase_C C1_2 Kinase-like zf-RING-like Zf_RING Haspin_kinase Pkinase_fungal DZR zf-RING_9 PHD APH DUF2318 CxC3
Motif
Other DBs
NCBI-GeneID: 102091654
NCBI-ProteinID: XP_005512415
UniProt: A0A2I0LSM6
LinkDB All DBs
Position
Unknown
AA seq 685 aa AA seqDB search
MAPFLRISFNSFELGPAQNQGEQPQPFCAIKMKEALTTERGKTLVQRKPTMYPEWKSTFD
AHIYEGRVIQIVLMKAAEEPLSEVTVGVSVLAERCKKGNGKAEFWLDLQPQGKVLMAVQY
FLEDTDCKQSLREEGATVTMNRRGAIKQAKIQYIKNHEFIATFFGQPTFCSVCKDFVWGL
NKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTMFQKERFKIDMPHRFKVYNYMSPN
FCDHCGSLLWGLVRQGLKCEECGMNVHHKCQTKVANLCGINQKLLAEALNQVSQKSTRKS
DSGSVENVGIYQDFDKKPKGPGGDTTADSSEYDKLWEGSTAKTAPRIATRRKFNIESFVF
HKVLGKGSFGKVLLAELKGKNEFFAIKALKKDVVLIDDDVECTMVEKRVLALAWENPFLT
HLYCTFQTKQHLFFVMEFLNGGDLMFHIQDKGRFDLYRATFYGAEILCGLQFLHSKGIIY
RDLKLDNVMLDKEGHIKIADFGMCKENVVGENKASTFCGTPDYIAPEILQGSRYTFSVDW
WSFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFERDPTRRL
GVTGSIRDHPFFKTINWTALEKREVDPPFRPKVKSASDYNNFDREFLSEKPKLSYSDKNL
IESMDQSAFAGFSFINPKFEQILDK
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcccccttcttacggatatctttcaactcatttgagctggggcctgcgcagaatcaa
ggagaacaaccgcagcctttctgtgctatcaagatgaaggaagcattgactacagagaga
ggaaaaactctagttcagaggaaacctaccatgtatccagaatggaaatcaactttcgac
gcccacatttacgaaggacgagtgattcagattgttctcatgaaagcagcagaagagcca
ttatctgaagtgactgtaggtgtgtcggtcctggcagagcggtgcaagaaaggcaacggc
aaagcagaattctggcttgacctacaacctcaggggaaggtgctgatggctgtgcagtat
tttttagaagatacagattgcaaacagtcattgagggaagaaggggcaacagtaactatg
aacaggagaggagctatcaagcaagccaaaatccagtacatcaaaaatcatgaatttatt
gctaccttctttggacaacctactttttgctctgtctgcaaggactttgtatggggactc
aacaagcagggatacaaatgtaggcaatgcaatgctgctattcataagaaatgtattgat
aaaatcattgggaggtgtactggtaccgcagccaacagcagggacacaatgtttcaaaag
gaacgtttcaaaatcgacatgcctcatcgcttcaaagtttacaattatatgagcccgaac
ttctgcgaccactgcggcagcctgctctgggggctggtcagacaggggctcaagtgtgaa
gaatgtgggatgaacgtgcatcataaatgccagacgaaggtggcaaacttatgtggaata
aaccagaagttgctagctgaagcgttaaatcaagttagccagaaatctactcgcaagtct
gattctggatctgtagaaaatgttggtatttatcaagactttgataagaaacctaaaggt
ccaggaggagatacaacagcagatagcagcgagtacgataaactctgggagggcagcaca
gccaagacagcgccacgaattgcaaccaggagaaaattcaacatagaaagctttgtcttc
cataaagtactagggaaaggaagttttggaaaggttctgcttgctgagctgaaagggaag
aacgaattctttgctatcaaagctctgaagaaagatgtggtgctaattgatgatgacgtg
gaatgtaccatggtggaaaagcgggtcctcgcacttgcatgggaaaatccatttctcacg
catctttactgcacgtttcagacaaagcaacatctgttctttgttatggagttcctgaat
gggggagacctgatgttccacatacaagacaaggggcgttttgatctctacagagcaacg
ttttatggagctgaaattttatgtgggctacagttccttcacagcaaaggcattatttat
agggacctaaaactggacaatgtgatgcttgataaagaaggccacatcaaaatagctgat
tttggaatgtgcaaagaaaatgttgttggtgagaacaaggcaagcacgttctgcgggacc
ccggactacattgctcctgagatcctgcaaggttcgaggtacacgttctctgtggactgg
tggtcatttggggtcctgctgtacgagatgcttattggacagtcccctttccatggggat
gatgaagatgaactgtttgagtcaatccgagtggacactcctcactacccacgctggatt
accaaggaatccaaggatatattggagaagctatttgaaagggatccaaccagacgactt
ggggtcactgggagtatcagagaccacccgttcttcaaaaccatcaactggacggcgctg
gagaagagggaggtggaccctccgttcaggccaaaagtgaagtcagcaagcgactacaac
aactttgacagagaattcctgagtgagaagccaaaattgtcctacagcgacaaaaacctg
atcgagtccatggatcagtccgcatttgctggattttcttttattaaccctaaatttgaa
cagatcttggacaagtaa

DBGET integrated database retrieval system