KEGG   Columba livia (rock pigeon): 102091738
Entry
102091738         CDS       T02912                                 

Gene name
THBS1
Definition
(RefSeq) LOW QUALITY PROTEIN: thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04115  p53 signaling pathway
clv04145  Phagosome
clv04350  TGF-beta signaling pathway
clv04510  Focal adhesion
clv04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    102091738 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    102091738 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    102091738 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    102091738 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102091738 (THBS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:clv04131]
    102091738 (THBS1)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:clv00536]
    102091738 (THBS1)
   04990 Domain-containing proteins not elsewhere classified [BR:clv04990]
    102091738 (THBS1)
Membrane trafficking [BR:clv04131]
 Endocytosis
  Phagocytosis
   Opsonins
    102091738 (THBS1)
Glycosaminoglycan binding proteins [BR:clv00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   102091738 (THBS1)
Domain-containing proteins not elsewhere classified [BR:clv04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   102091738 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS cEGF Laminin_G_3 TSP1_CCN EGF Laminin_G_2
Other DBs
NCBI-GeneID: 102091738
NCBI-ProteinID: XP_005502344
LinkDB
Position
Unknown
AA seq 1166 aa
MGPATVLFLLLMLGVSETKRTAESRSDDNSVFDLFELIGFIRKGAGRRAPGVHLVKGPEP
SSPAYXPDSKFQDLLDAIHAEKGFILLANLRQAKKSRGTLLSVEQKDGSGHVFSLVSNGK
AGTLDLSLSGDGKQQLVSVEDALLATGHWKNITLFVQEDRAQLYVGCEKMENAELDIPIQ
NIFTRDLASSARLRIAKGGVNDNFQGLLQNVRFVFGTTLETILRNKGCSSSTNAIITLDN
PINGSSPAIRTNYIGHKTKDIQAVCGFSCDELTNMFVELQGLRSMVTTLQDRVRKVTEEN
ELIAKVVQITPGVCIHNGILHKNKEEWTIDSCTECTCQNSATICRKVSCPLMPCSNATVP
DGECCPRCWPSDYADDGWSPWSEWTSCSVTCGNGIQQRGRSCDSLNNRCEGSSVQTRTCH
LQECDKRFKQDGGWSHWSPWSSCSVTCGTGIITRIRLCNSPVPQLNGKPCEGEARENKSC
QKDPCPINGNWGPWSPWDACTVTCGGGLQKRSRLCNNPEPQYGGKTCVGEAKGTQICNKQ
DCPIDGCLSNPCFAGTTCTSSPDGSWKCGDCPAGYHGDGVHCQDIDECKEVSDACFVFNG
VHRCENTDPGYNCLPCPPRFTGTQPFGRSVEDAMANKQVCKPRNPCTDGTHDCNKNAKCN
YLGHFSDPMYRCECKPGYAGNGIICGEDTDLDGWPNENLVCVANATYHCKKDNCPNLPNS
GQEDYDKDGIGDACDNDDDDDSIPDDRDNCPFIYNPQQYDYDRDEVGDRCDNCPYNHNPD
QTDTDNNGEGDACAVDIDGDGVLNEMDNCQYVYNVDQRDTDLDGVGDQCDNCPLEHNPDQ
EDTDSDLIGDQCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDNDGIP
DDKDNCRLVANPDQADSDGDGRGDACKDDFDQDSVPDIDDICPENVDISETDFRKFQMIP
LDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGFDEFNAVDFSGTFFINTERDDDYAG
FVFGYQSSSRFYVVMWKQITQSYWDSTPTKAQGYSGLSIKVVNSTTGPGEHLRNALWHTG
NTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGYIRVVMYEGKKIMADSGPIYDKTYA
GGRLGLFVFSQEMVFFSDLKYECRDP
NT seq 3501 nt   +upstreamnt  +downstreamnt
atggggccagcgactgttctttttctcctcctcatgctcggcgtctcggagaccaagcgc
accgcagagtccaggagtgatgataacagtgtcttcgatctctttgagctcatcggtttc
atccggaagggagctgggcgccgggcacccggggtgcacctggtgaagggaccagaaccc
tcaagccctgcttacncgcctgactccaagttccaagacttattagatgccatccatgct
gagaagggcttcattctcctggccaatcttcggcaagccaagaagagtagaggcacgctg
ctgtctgtggagcagaaggatggctctggccatgtctttagtctagtatcaaatggcaag
gcaggcaccctggacctgagcctttctggtgatggcaagcagcagttagtgtcagtagag
gatgccttgctggctacaggacactggaagaacatcaccttgtttgtgcaggaggaccgg
gctcagctctatgtggggtgtgagaaaatggagaatgctgaattggacatccccatccag
aacattttcactagggacctggccagcagtgccaggctccgtattgccaaaggaggagtc
aatgacaacttccagggactgctgcagaatgtgcggtttgtgtttggaacaactctggaa
actatcctgaggaacaaaggctgctccagctccactaatgcaatcattactttggacaac
cccatcaatggttccagcccagctatccgcactaattacattggccataaaacaaaggac
atccaagcagtctgtggtttttcctgtgatgaactaacaaatatgtttgtggaactgcaa
gggctccggtccatggttacaacacttcaagacagagttcgcaaagtgactgaagaaaat
gaactcattgccaaagtggtccagatcactcctggagtatgcattcataatggaatcttg
cacaaaaataaagaggagtggaccattgacagctgcactgaatgcacctgccagaactcc
gccactatatgccggaaagtgtcctgtcctctcatgccttgttccaatgccactgtgcct
gatggggagtgctgcccccgatgctggcctagcgactatgcagatgacggatggtctccc
tggtctgaatggacttcatgttctgtgacctgtgggaatgggattcagcagagaggccga
tcctgtgacagtctcaacaaccgctgtgaagggtcttctgtacagactcggacatgccac
cttcaggagtgcgataagagatttaaacaagatggtggctggagtcactggtcaccatgg
tcatcatgttctgtcacttgtggcacgggcattatcactagaattcgtctctgcaactct
ccagtaccacagctgaatggcaaaccttgtgagggtgaggcaagagaaaacaaatcctgc
cagaaggatccttgcccaattaacggcaactggggaccatggtctccgtgggatgcttgc
acagtgacatgtggaggagggctgcaaaaacgtagccgtctctgcaataatcctgagcct
cagtatggtgggaagacttgtgtaggtgaagctaaaggcactcagatctgcaacaaacag
gactgtccaattgatgggtgtctgtccaatccctgctttgcggggactacatgtaccagc
tcccctgatggctcctggaagtgtggtgactgtcctgctggctaccatggtgatggtgtc
cactgccaagatattgatgagtgcaaagaggtttctgatgcctgctttgtcttcaatgga
gtgcacagatgtgagaacactgatcctgggtacaactgtctgccttgtccaccacgtttc
acggggacacaaccatttggtcgcagtgttgaggatgccatggctaataaacaggtctgc
aagccacgtaatccatgcacagatggaacacatgattgcaacaagaatgccaaatgcaat
taccttgggcacttcagtgatcccatgtatcgctgtgaatgtaaaccaggctatgctggc
aatggcataatctgtggagaagatactgacttggatggatggccaaatgagaatcttgtt
tgtgttgccaatgccacttaccactgtaaaaaagataactgtcctaatctgcccaactct
gggcaggaagactatgataaggatgggattggtgatgcctgtgacaatgatgacgatgat
gatagtattcctgatgaccgggacaactgtccattcatctacaacccacagcagtatgac
tatgacagggatgaagtgggtgaccgctgtgataactgcccctacaatcacaaccctgat
caaacagacactgacaacaatggagaaggagatgcatgtgcggtcgatattgatggagat
ggggttcttaatgaaatggacaactgccaatatgtctacaatgtagaccagagggataca
gacttggatggtgttggagatcaatgtgataactgtcctctggaacacaatcctgaccag
gaagacactgattctgacctcataggtgatcagtgcgacaataaccaggatatagatgaa
gatggccatcaaaataaccttgataactgcccctatgtgcccaatgccaatcaagctgac
catgataaagatgggaaaggtgatgcttgtgaccatgatgatgacaatgatggtatccca
gatgacaaagataactgcagattggttgccaacccagatcaagctgattctgatggtgat
ggacgtggagatgcttgcaaagatgactttgaccaagacagtgtgccagacattgatgat
atctgccctgaaaatgtggacattagtgaaactgatttccgaaaattccagatgattccc
ctggatcccaaaggaacatcccaaaatgatccaaactgggtggttcgtcaccagggcaaa
gaactggttcagacagtcaactgtgaccctggccttgcagtcggttttgatgaattcaat
gctgtggacttcagtggcaccttcttcatcaatacagagagggatgacgattatgctggc
tttgtatttggctaccaatctagcagtcgtttctatgttgtcatgtggaagcagatcact
cagtcttactgggactccacaccaaccaaagctcaaggctactcaggtctctccatcaaa
gttgtgaattctaccactggtccaggagaacaccttcgtaatgctctgtggcacacaggc
aacactcctggccaggtgagaactttgtggcatgaccctcgtcacataggctggaaagac
ttcactgcatacagatggcgtcttagccatagaccaaagactggttacatcagggttgta
atgtatgaagggaagaaaatcatggcagactcgggaccaatctacgataaaacctatgct
ggtggtcggctaggattgtttgtcttctctcaagaaatggtgttcttctcagatcttaaa
tatgaatgcagagatccataa

DBGET integrated database retrieval system