KEGG   Columba livia (rock pigeon): 102091815Help
Entry
102091815         CDS       T02912                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial isoform X4
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00020  Citrate cycle (TCA cycle)
clv00190  Oxidative phosphorylation
clv01100  Metabolic pathways
clv01200  Carbon metabolism
Module
clv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
clv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
clv_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102091815
  Energy metabolism
   00190 Oxidative phosphorylation
    102091815
Enzymes [BR:clv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102091815
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer2 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 102091815
NCBI-ProteinID: XP_005508025
UniProt: A0A2I0M368
LinkDB All DBs
Position
Unknown
AA seq 266 aa AA seqDB search
MGKFGERRVGMCRGAQTAAAAAPRIKKFAIYRWDPDKPGDKPRMQTYEVDLNKCGPMVLD
ALIKIKNEVDSTLTFRRSCREGICGSCAMNIAGGNTLACIKRIDPDLNKITKIYPLPHMY
VVKDLVPDLSNFYAQYKSIEPYLKKKDESKQGKEQYLQSIEDRQKLDGLYECILCACCST
SCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYTEERLAQLQDPFSLYRCHTIMNCTRTCP
KGLNPGKAIAEIKKMMATYKQKATAA
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggggaaatttggggagaggcgagtagggatgtgccggggagcgcagacagcagccgca
gccgcgcctcggatcaagaagtttgctatctaccgatgggatcccgacaagcctggggac
aagccccgcatgcagacatacgaagtggatctgaataaatgtgggcctatggtgctggat
gctctgatcaagataaaaaatgaggtggactccactctgaccttccgcagatcatgtcgg
gaaggcatctgcggctcttgtgctatgaacatcgcaggtggcaacacgctggcctgtatc
aaaagaattgaccccgatctcaacaaaatcactaaaatctaccctctcccgcacatgtac
gtggtgaaggaccttgttcccgacttgagtaacttctacgcacaatacaaatccatcgag
ccttacctgaagaagaaggatgagtcaaaacagggcaaggagcagtatctgcagtccatc
gaagaccgtcagaaactggacggactctacgagtgcatcctgtgcgcctgctgcagcacc
agttgccccagttactggtggaacggggacaagtacctgggtcctgccgtgctgatgcag
gcctatcgctggatgattgactcccgagatgactacacagaggagcgcctggcgcagctg
caagacccgttttctctctatcgttgtcacacgatcatgaattgcacgcggacttgcccg
aagggtttgaaccctggcaaagcaattgctgagatcaagaagatgatggcgacgtacaaa
cagaaggcgaccgccgcgtaa

DBGET integrated database retrieval system