KEGG   Columba livia (rock pigeon): 102091992
Entry
102091992         CDS       T02912                                 

Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04060  Cytokine-cytokine receptor interaction
clv04068  FoxO signaling pathway
clv04144  Endocytosis
clv04218  Cellular senescence
clv04350  TGF-beta signaling pathway
clv04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102091992
   04350 TGF-beta signaling pathway
    102091992
   04068 FoxO signaling pathway
    102091992
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102091992
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102091992
  09143 Cell growth and death
   04218 Cellular senescence
    102091992
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102091992
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:clv01001]
    102091992
Enzymes [BR:clv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102091992
Protein kinases [BR:clv01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102091992
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal FixQ
Other DBs
NCBI-GeneID: 102091992
NCBI-ProteinID: XP_021146877
LinkDB
Position
Unknown
AA seq 565 aa
MGYWRRPGLLSLLLLSFSCSAGARRSLKTNLCKWCDSTPPACEEKVCYSNCNLNSYCEDP
YEICVAIWRQDNESIRISTLCHNPHRPIENLMVPNYNTSRCIMTHQPSEDGIIYICGCVD
EQECNDKLIFENHTNGYSMLQSKEVIPVAAISLLPPLLVAVMITVIFYLCRTQKRRKRAK
AWGGKPRQPPALPEPGRSAEKEEKLSVLMDESPAATSPVCANNRPAELLPIELDEMVGKG
QFAEVWRAKLSHSRSGQYETVAVKIFPCEEYSSWKNESQIFTDASLKHDSVLRFLTAEDR
GTGPRREYWLITAYHSRGNLKDYLSRHVLSWMDLQKMAGSLVSGVAHLHSDYTACGRPKI
PIAHRDIKSTNVLVKNEQECVLCDFGIAIRLDPSLTVDDFANSGQVGTARYMAPEVLESR
VNLEDLESFKQMDVYSMALVLWEMASRCEVVGEVKNYELPFGSKVQEQPCVDTMRDIVLH
GRGRPEIPSSWLVHQGMRFLCDTITECWDHDPEARLTAHCVAERFNLMAQMDCDDILNNN
TDNEASKTASPGGEHQDSDGSRNTQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atgggttactggaggagaccgggtctgctttccttactgctgctctccttctcctgcagt
gccggcgcccgccgcagcctcaagaccaacctgtgcaagtggtgcgactccacaccgccc
gcctgcgaggagaaggtgtgctacagcaactgcaacctcaattcttactgcgaggacccc
tacgagatctgcgtggccatatggagacaggacaacgagagcatcaggatcagcacactc
tgccacaacccccatcgccccattgaaaacctcatggtccccaactacaacacctcgcgc
tgcatcatgacccaccagcccagcgaggacgggatcatctacatctgtggctgcgtggat
gagcaggagtgcaacgataaactcatctttgaaaaccacacgaacggctactccatgctg
cagagcaaagaggtcatcccggtggccgccatcagcctcctgcccccgctgctggtggcc
gtgatgatcactgtgatcttctacctctgccgcacgcagaagcgacgcaagagagccaag
gcgtggggagggaaaccgaggcagcccccggcactgccggagccagggaggtccgctgag
aaggaggaaaagttgtccgtgctgatggacgagagcccggccgccaccagccccgtctgt
gccaacaaccgccccgccgagctgctccccatcgagctggacgagatggtgggcaaaggg
cagtttgcggaggtgtggagggccaagctgagccacagccgctcggggcagtacgagacg
gtggctgtgaagatcttcccctgcgaggagtactcctcctggaagaatgagagccagatc
ttcaccgacgccagcctgaagcacgacagcgtcctgcggttcctcaccgccgaggaccgg
ggcacggggccccgccgggagtactggctcatcaccgcctaccacagccggggcaacctc
aaggactacctctcccgccatgtcctgagctggatggacctgcagaagatggcaggctcc
ctggtgagcggggtggcccatctccacagtgactacactgcctgcggcaggccaaaaatc
cccatcgcccaccgggacatcaaaagcaccaacgtcctggtgaagaacgagcaggagtgc
gtgctctgtgacttcggcattgccatacgcctcgacccttccctgacagtggacgacttt
gccaacagcggtcaggtgggcactgccaggtacatggccccagaggtcctggagtctagg
gtgaacctggaagacctggagtctttcaagcagatggatgtctactccatggccctcgtt
ttgtgggaaatggcctccagatgtgaagtggtaggagaggtaaagaattacgagctgccc
tttgggtcaaaagtccaggagcagccctgcgtggacaccatgagggacatcgtgctgcac
ggcagaggacgccccgagatcccgagcagctggctggtgcatcaggggatgcgctttctg
tgcgacaccatcacggagtgctgggaccacgaccccgaggcccggctcaccgcccactgc
gtggccgagcgcttcaacctgatggcgcagatggattgtgacgacatcctcaacaacaac
acggacaacgaggccagcaaaacagcttctcccggcggggagcaccaggacagtgacggg
agcagaaatacgcagtga

DBGET integrated database retrieval system