KEGG   Columba livia (rock pigeon): 102092089
Entry
102092089         CDS       T02912                                 

Gene name
IGF1
Definition
(RefSeq) insulin-like growth factor I
  KO
K05459  insulin-like growth factor 1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04068  FoxO signaling pathway
clv04114  Oocyte meiosis
clv04115  p53 signaling pathway
clv04150  mTOR signaling pathway
clv04510  Focal adhesion
clv04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102092089 (IGF1)
   04068 FoxO signaling pathway
    102092089 (IGF1)
   04150 mTOR signaling pathway
    102092089 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102092089 (IGF1)
   04115 p53 signaling pathway
    102092089 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102092089 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102092089 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:clv04052]
    102092089 (IGF1)
Cytokines and growth factors [BR:clv04052]
 Growth factors
  Growth factors (RTK binding)
   102092089 (IGF1)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 102092089
NCBI-ProteinID: XP_005500337
UniProt: A0A2I0MK45
LinkDB
Position
Unknown
AA seq 153 aa
MEKINSLSTQLVKCCFCDFLKVKMHTVSYIHFFYLGLCLLTLTSSAAAGPETLCGAELVD
ALQFVCGDRGFYFSKPTGYGSSSRRLHHKGIVDECCFQSCDLRRLEMYCAPIKPPKSARS
VRAQRHTDMPKAQKEVHLKNTSRGNTGNRNYRM
NT seq 462 nt   +upstreamnt  +downstreamnt
atggaaaaaatcaacagtctttcaacacaattagttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacactgtgtcctacattcatttcttctaccttggcctgtgtttgctt
accttaaccagttctgctgctgctggcccagaaacactctgtggtgctgagctggttgat
gctcttcagttcgtgtgtggagacagaggcttttacttcagtaagcctacagggtatgga
tccagcagtagacgcttacaccacaagggaatagtggatgaatgctgcttccagagttgt
gacctgaggaggctggagatgtattgtgctccaataaagccacctaaatctgcacgctct
gtacgtgctcagcgccacactgatatgccaaaagcacaaaaggaagtgcatttgaagaat
acaagtagagggaacacaggaaacagaaactacagaatgtaa

DBGET integrated database retrieval system