KEGG   Columba livia (rock pigeon): 102092209
Entry
102092209         CDS       T02912                                 

Gene name
JUN
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04010  MAPK signaling pathway
clv04012  ErbB signaling pathway
clv04137  Mitophagy - animal
clv04210  Apoptosis
clv04310  Wnt signaling pathway
clv04510  Focal adhesion
clv04530  Tight junction
clv04620  Toll-like receptor signaling pathway
clv04621  NOD-like receptor signaling pathway
clv04625  C-type lectin receptor signaling pathway
clv04912  GnRH signaling pathway
clv05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102092209 (JUN)
   04012 ErbB signaling pathway
    102092209 (JUN)
   04310 Wnt signaling pathway
    102092209 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    102092209 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    102092209 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102092209 (JUN)
   04530 Tight junction
    102092209 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    102092209 (JUN)
   04621 NOD-like receptor signaling pathway
    102092209 (JUN)
   04625 C-type lectin receptor signaling pathway
    102092209 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    102092209 (JUN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102092209 (JUN)
Transcription factors [BR:clv03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    102092209 (JUN)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha FlaC_arch Spc29 NAM-associated Jnk-SapK_ap_N DUF3450
Other DBs
NCBI-GeneID: 102092209
NCBI-ProteinID: XP_005516004
LinkDB
Position
Unknown
AA seq 316 aa
MSAKMEPTFYEDALNASFVPPESGGGGYGYNNAKVLKQNMTLNLSDPSSNLKPHLRNKNA
DILTSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFLCPKNVTDEQEGFAEGFVRAL
AELHNQNTMPSVTSAAQPVNSGMAPVSSMAGNSSFNTNLHSEPPVYANLSNFNPNALNSA
PNYNTNSMGYAPQHHINPQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKA
ERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNH
VNSGCQLMLTQQLQTF
NT seq 951 nt   +upstreamnt  +downstreamnt
atgagtgcaaagatggagcctactttctacgaggatgccttgaacgccagcttcgtgccg
ccggagagcggcggggggggatatggatataataacgccaaagtgctgaagcagaacatg
acgctgaacctgtccgacccatccagcaacctgaagccgcacctgaggaacaagaacgcc
gacatcctcacgtcccccgacgtgggactcctgaaactggcctcgcctgaactggagcgg
ctcatcatccagtccagcaacgggttaatcaccaccacgccgaccccgacgcagttcctc
tgccccaaaaacgttaccgatgagcaagaggggttcgcggaaggctttgtgagagccctg
gcagaactgcacaaccagaacactatgcccagcgtcacctccgctgctcaacctgttaac
agcggcatggcacctgtgtcttctatggccggcaacagcagcttcaacacgaatttacac
agcgagccgccagtgtacgccaatctcagcaacttcaaccccaacgcactcaactctgca
cctaactacaacacaaacagcatgggctatgcacctcagcatcacataaacccccagatg
ccggtgcagcatcccaggcttcaggctttaaaagaagagcctcagactgtacctgaaatg
ccaggggaaactcctcccctgtcccctattgacatggagtcacaggagagaatcaaagct
gagagaaaacgtatgagaaacagaattgcagcatccaaatgccggaaaaggaagttggaa
aggattgccaggttggaagaaaaagtgaaaactttgaaagcccagaactcagagctggca
tccactgccaacatgctcagagaacaggttgcacagcttaagcagaaggtcatgaaccat
gtcaacagcgggtgccagctaatgctaacacaacagttgcaaacattttga

DBGET integrated database retrieval system