KEGG   Columba livia (rock pigeon): 102092237
Entry
102092237         CDS       T02912                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04012  ErbB signaling pathway
clv04068  FoxO signaling pathway
clv04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:clv00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102092237 (CDKN1B)
   04068 FoxO signaling pathway
    102092237 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102092237 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102092237
NCBI-ProteinID: XP_005510556
UniProt: A0A2I0MKE6
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRISNGSPTLERMEARQSEYPKPSACRNLFGPVNHEELNRDLKKHRQEMEEACQRKW
NFDFQNHKPLEGRYEWQAVEKGSSPDFYFRPPRLLKAVCKSASRQSLDVNGNCQNVVFVG
SQGISEDTHCVDQKTDVSENQTDFAEQCTGQRKRPATDDSSPQNKRANTTEEEVSEDSPS
ASSVEQTPKKSSPRRHQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtccgtatttctaatgggagccctactctggagcgcatggaagccaggcag
tcggagtacccgaagccttcagcttgcaggaacctcttcgggccggtgaatcacgaagag
ttaaacagggacttgaagaagcaccgccaggagatggaggaggcatgccagaggaagtgg
aatttcgatttccagaatcacaagccgctggaaggcaggtacgagtggcaagccgtggag
aaggggagctcgcctgacttctacttcagaccccccaggctactgaaagctgtctgcaag
tccgccagccgccagagcttggacgtaaacgggaattgccaaaacgtggtttttgtcggc
tctcagggaatctcagaggacactcactgtgtagatcaaaagactgatgtttctgaaaat
cagacggactttgcagagcagtgcactgggcagaggaaaagacctgccaccgatgattcc
tctcctcaaaataaaagagccaacacaacagaagaagaggtttcagaagactcccccagt
gccagttcagtggagcaaacacccaagaaatcaagcccaagaagacatcaaacgtaa

DBGET integrated database retrieval system